Clone Name | rbaak4i20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYN_THEAC (Q9HKS7) Asparaginyl-tRNA synthetase (EC 6.1.1.22) (As... | 29 | 2.8 | 2 | LPQT_MYCTU (P96384) Putative lipoprotein lpqT precursor | 29 | 2.8 | 3 | ABCA_AERSA (Q07698) ABC transporter protein abcA | 28 | 8.1 | 4 | AMPR_YEREN (P45461) HTH-type transcriptional activator ampR | 28 | 8.1 |
---|
>SYN_THEAC (Q9HKS7) Asparaginyl-tRNA synthetase (EC 6.1.1.22)| (Asparagine--tRNA ligase) (AsnRS) Length = 429 Score = 29.3 bits (64), Expect = 2.8 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +1 Query: 70 RRSRGYELTIESTHVYQYHGQSILAILFDSREAFQAENTISGRYVLVSQQFTHLRKFRS 246 R GYE+ ++S VYQ + + I D E F +N L S++FT + K RS Sbjct: 81 RSPSGYEIAVDSFRVYQKN--DVFPITKDQGEEFLLDNR---HLWLRSREFTSVLKIRS 134
>LPQT_MYCTU (P96384) Putative lipoprotein lpqT precursor| Length = 226 Score = 29.3 bits (64), Expect = 2.8 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 9/47 (19%) Frame = -2 Query: 214 G*RVHTYRRWCFPPEMPP*SQREL---------QECSAHDTDIHALI 101 G R+HT+ R FP PP QR L E H +DI A+I Sbjct: 172 GRRLHTWNRIVFPTGAPPAKQRYLVQLTITSLANEAVKHASDIEAII 218
>ABCA_AERSA (Q07698) ABC transporter protein abcA| Length = 308 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 219 LLADEYIPTGDGVFRLKCLPRVKENCKNALPMILI 115 L+ DE + GD F+ KC R+K+ + ++L+ Sbjct: 167 LIIDEALAVGDDAFQRKCYARLKQLQSQGVTILLV 201
>AMPR_YEREN (P45461) HTH-type transcriptional activator ampR| Length = 294 Score = 27.7 bits (60), Expect = 8.1 Identities = 20/46 (43%), Positives = 24/46 (52%) Frame = +1 Query: 22 RGTEHRGNCDSNRLFFRRSRGYELTIESTHVYQYHGQSILAILFDS 159 + E R NC RLF R SRG LT E G+++L IL DS Sbjct: 42 KALEQRLNC---RLFIRISRGLVLTTE--------GENLLPILNDS 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,366,155 Number of Sequences: 219361 Number of extensions: 564644 Number of successful extensions: 1470 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1470 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)