Clone Name | rbaak4i13 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SHH_CHICK (Q91035) Sonic hedgehog protein precursor (SHH) [Conta... | 30 | 4.4 | 2 | SYW_RABIT (P23612) Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Tr... | 29 | 7.6 | 3 | DYHC_DROME (P37276) Dynein heavy chain, cytosolic (DYHC) | 28 | 9.9 |
---|
>SHH_CHICK (Q91035) Sonic hedgehog protein precursor (SHH) [Contains: Sonic| hedgehog protein N-product; Sonic hedgehog protein C-product] Length = 425 Score = 29.6 bits (65), Expect = 4.4 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 476 ACVCDDGANTLRCGDARSLHWKRQKLYKIGSTV 378 A +C DGA +HW + LY+IGS V Sbjct: 377 AALCPDGAIPTAATTTTGIHWYSRLLYRIGSWV 409
>SYW_RABIT (P23612) Tryptophanyl-tRNA synthetase (EC 6.1.1.2)| (Tryptophan--tRNA ligase) (TrpRS) Length = 475 Score = 28.9 bits (63), Expect = 7.6 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 154 EAYKPKCPLGGSTP-SRGNPPSLLDEPD 234 E YK CP G STP S G+P ++ D+ D Sbjct: 60 EDYKADCPPGNSTPDSHGDPEAVDDKED 87
>DYHC_DROME (P37276) Dynein heavy chain, cytosolic (DYHC)| Length = 4639 Score = 28.5 bits (62), Expect = 9.9 Identities = 25/86 (29%), Positives = 33/86 (38%) Frame = +1 Query: 112 HLQQTHLGAKLYIHEAYKPKCPLGGSTPSRGNPPSLLDEPDPV*LVKRLKETSTVP*KEH 291 H Q H G +L++ PK P+ R + EP P L+ STVP Sbjct: 4098 HSLQPHSGFRLFLTMEINPKVPVNLLRAGR----IFVFEPPPGIRANLLRTFSTVPAARM 4153 Query: 292 ITRLLEIVELYFL*PKKHAKNSRHIR 369 + E LYFL HA +R Sbjct: 4154 MKTPSERARLYFLLAWFHAIVQERLR 4179 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,411,171 Number of Sequences: 219361 Number of extensions: 1447183 Number of successful extensions: 2844 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2843 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)