Clone Name | rbaak4h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ALR3_SALTI (Q8Z300) Alanine racemase 3 (EC 5.1.1.1) | 30 | 6.0 | 2 | TRDN_RABIT (Q28820) Triadin | 29 | 7.9 |
---|
>ALR3_SALTI (Q8Z300) Alanine racemase 3 (EC 5.1.1.1)| Length = 368 Score = 29.6 bits (65), Expect = 6.0 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 6/58 (10%) Frame = -3 Query: 378 QTWKSTPH*PVFLLPLTVSR------GIPAPPGLIVTHTARVSVAAAPVPLWNATPHN 223 Q W STP P F L LT+ R G P G VT T + +A + P N Sbjct: 231 QPWFSTPLKPAFTLTLTILRVQDVPVGTPIGYGSTVTTTRPLRIATVSAGYADGIPRN 288
>TRDN_RABIT (Q28820) Triadin| Length = 705 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 303 EELEFHG*PSRVVEKQVNAVWTSKFERRAGGQDQLAGCDHFQRQPPELDVSTPDANA 473 E+ HG P V KQV AV T K + + +H +++PP + P + + Sbjct: 538 EKTALHGKPEEKVLKQVKAVTTEKHVKPKPAKK----AEHQEKEPPSIKTDKPKSTS 590 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,708,816 Number of Sequences: 219361 Number of extensions: 1534699 Number of successful extensions: 3441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3441 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)