| Clone Name | rbaak4g20 |
|---|---|
| Clone Library Name | barley_pub |
>BLT4_HORVU (P25307) BLT4 protein precursor| Length = 130 Score = 64.7 bits (156), Expect = 5e-11 Identities = 36/47 (76%), Positives = 37/47 (78%) Frame = -2 Query: 365 GRRHPPPGAASASPTRSAPVSTAPRSTDRTRASIIAVHTSSDRRLVG 225 G + PPGAASASPTRSAPVSTA RSTDRTRA H SSDRRLVG Sbjct: 88 GPQASPPGAASASPTRSAPVSTALRSTDRTRAP----HISSDRRLVG 130
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 PSRCGVSVPYTISASVDC+KIH Sbjct: 94 PSRCGVSVPYTISASVDCSKIH 115
>NLTP1_ORYSA (P23096) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (PAPI) Length = 116 Score = 42.7 bits (99), Expect = 2e-04 Identities = 16/21 (76%), Positives = 21/21 (100%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS+CGVSVPYTISAS+DC+++ Sbjct: 95 PSKCGVSVPYTISASIDCSRV 115
>NLT43_HORVU (Q42842) Nonspecific lipid-transfer protein 4.3 precursor (LTP 4.3)| Length = 115 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS CGVSVPY ISASVDC+KI Sbjct: 94 PSMCGVSVPYAISASVDCSKI 114
>NLT42_HORVU (Q43875) Nonspecific lipid-transfer protein 4.2 precursor (LTP 4.2)| (Low-temperature-responsive protein 4.9) Length = 115 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS CGVSVPY ISASVDC+KI Sbjct: 94 PSMCGVSVPYAISASVDCSKI 114
>NLT41_HORVU (Q43767) Nonspecific lipid-transfer protein 4.1 precursor (LTP 4.1)| (CW21) (CW-21) Length = 115 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS CGVSVPY ISASVDC+KI Sbjct: 94 PSMCGVSVPYAISASVDCSKI 114
>NLTP3_ORYSA (Q42999) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 40.8 bits (94), Expect = 8e-04 Identities = 14/22 (63%), Positives = 21/22 (95%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 PS+CGVS+PYTIS S+DC++++ Sbjct: 96 PSKCGVSIPYTISPSIDCSRVN 117
>NLTP1_SORBI (Q43193) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 40.0 bits (92), Expect = 0.001 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS+CGVSVPYTIS S DC+++ Sbjct: 97 PSKCGVSVPYTISTSTDCSRV 117
>NLTP_MAIZE (P19656) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (Allergen Zea m 14) Length = 120 Score = 40.0 bits (92), Expect = 0.001 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 PS+CGVS+PYTIS S DC++++ Sbjct: 99 PSKCGVSIPYTISTSTDCSRVN 120
>NLTP2_SORBI (Q43194) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 122 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS+CGVS+PYTIS S DC+++ Sbjct: 101 PSKCGVSIPYTISTSTDCSRV 121
>NLTP5_ORYSA (O65091) Nonspecific lipid-transfer protein 5 precursor (LTP 5)| Length = 117 Score = 39.3 bits (90), Expect = 0.002 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 PS+CGV++PY IS S DC+++H Sbjct: 96 PSKCGVNIPYAISPSTDCSRVH 117
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 38.9 bits (89), Expect = 0.003 Identities = 13/22 (59%), Positives = 20/22 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 PS+CGV++PYTIS S+DC+ ++ Sbjct: 97 PSKCGVTIPYTISPSIDCSSVN 118
>NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| (CW20) (CW-20) (CW-19) Length = 118 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 P +CGVSVP+ IS S DC K+H Sbjct: 97 PGKCGVSVPFPISMSTDCNKVH 118
>NLTP_ELECO (P23802) Nonspecific lipid-transfer protein (LTP) (Alpha-amylase| inhibitor I-2) Length = 95 Score = 37.7 bits (86), Expect = 0.007 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 P RCGV +PY ISAS+DC++++ Sbjct: 73 PGRCGVRLPYAISASIDCSRVN 94
>NLTP1_HORVU (P07597) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Probable amylase/protease inhibitor) Length = 117 Score = 37.0 bits (84), Expect = 0.012 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 PS+C V+VPYTIS +DC++I+ Sbjct: 96 PSKCNVNVPYTISPDIDCSRIY 117
>NLTP4_ORYSA (Q42976) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 121 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 PS+CGVSV + IS SVDC+KI+ Sbjct: 100 PSKCGVSVAFPISTSVDCSKIN 121
>NLTP_HELAN (Q39950) Nonspecific lipid-transfer protein precursor (LTP) (NsLTP)| (SDI-9) Length = 116 Score = 36.6 bits (83), Expect = 0.015 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGVS+PY IS S DC+K+ Sbjct: 95 PGKCGVSIPYKISPSTDCSKV 115
>NLTP1_TOBAC (Q42952) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Pathogenesis-related protein 14) (PR-14) Length = 114 Score = 35.8 bits (81), Expect = 0.026 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS CGV++PY IS S DC+K+ Sbjct: 93 PSTCGVNIPYKISPSTDCSKV 113
>NLTP1_WHEAT (P24296) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (ns-LTP1) (Fragment) Length = 113 Score = 35.4 bits (80), Expect = 0.034 Identities = 11/21 (52%), Positives = 19/21 (90%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGV++PYTIS ++DC+++ Sbjct: 93 PPKCGVNLPYTISLNIDCSRV 113
>NLTP_GERHY (Q39794) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 35.0 bits (79), Expect = 0.045 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 P +CG+S+ Y I+ ++DC+KIH Sbjct: 95 PGKCGISIGYKITPNIDCSKIH 116
>NLTP_BETVU (Q43748) Nonspecific lipid-transfer protein precursor (LTP)| Length = 117 Score = 34.3 bits (77), Expect = 0.076 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 P +CGVSVPY IS + +C IH Sbjct: 96 PRQCGVSVPYAISPNTNCNAIH 117
>NLTP2_TOBAC (Q03461) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 34.3 bits (77), Expect = 0.076 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS S DC+K+ Sbjct: 93 PGACGVNIPYKISPSTDCSKV 113
>NLTP_DAUCA (P27631) Nonspecific lipid-transfer protein precursor (LTP)| (Extracellular protein 2) Length = 120 Score = 34.3 bits (77), Expect = 0.076 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P+RCGV++PY IS + DC ++ Sbjct: 99 PARCGVNIPYKISPTTDCNRV 119
>NLTP1_PRUDO (P82534) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru d 3) Length = 91 Score = 33.9 bits (76), Expect = 0.100 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 357 ASPSRCGVSVPYTISASVDCTKI 289 A P +CGV+VPY ISAS +C + Sbjct: 68 ALPGKCGVNVPYKISASTNCATV 90
>NLTP1_PHAAU (P83434) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 91 Score = 33.9 bits (76), Expect = 0.100 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 360 QASPSRCGVSVPYTISASVDCTKIH 286 +A P +CGV++PY IS S +C I+ Sbjct: 67 EALPGKCGVNIPYKISTSTNCNSIN 91
>NLTP1_PRUAR (P81651) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru ar 3) Length = 91 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 357 ASPSRCGVSVPYTISASVDCTKI 289 A P +CGV++PY ISAS +C + Sbjct: 68 ALPGKCGVNIPYKISASTNCATV 90
>NLTP2_GOSHI (Q43129) Nonspecific lipid-transfer protein precursor (LTP) (GH3)| Length = 120 Score = 33.1 bits (74), Expect = 0.17 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGV++PY IS S DC + Sbjct: 99 PGKCGVNIPYKISPSTDCNSV 119
>NLTP3_PRUDU (Q43019) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 123 Score = 33.1 bits (74), Expect = 0.17 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGV++PY IS S DC I Sbjct: 102 PGKCGVNIPYKISPSTDCKSI 122
>NLTP1_GOSHI (Q42762) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 33.1 bits (74), Expect = 0.17 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGV++PY IS S DC + Sbjct: 95 PGKCGVNIPYKISPSTDCNSV 115
>NLTP1_PRUPE (P81402) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru p 3) (Pru p 1) Length = 91 Score = 32.7 bits (73), Expect = 0.22 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 357 ASPSRCGVSVPYTISASVDCTKI 289 A P +CGV +PY ISAS +C + Sbjct: 68 ALPGKCGVHIPYKISASTNCATV 90
>NLTP4_ARATH (Q9LLR6) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 112 Score = 32.7 bits (73), Expect = 0.22 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGVS+PY IS S +C I Sbjct: 91 PGKCGVSIPYPISTSTNCATI 111
>NLTP3_ARATH (Q9LLR7) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 115 Score = 32.7 bits (73), Expect = 0.22 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGVS+PY IS S +C I Sbjct: 94 PGKCGVSIPYPISMSTNCNNI 114
>NLTP_SPIOL (P10976) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) Length = 117 Score = 32.3 bits (72), Expect = 0.29 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKIH 286 P CGV +PY IS S +C +H Sbjct: 96 PGMCGVHIPYAISPSTNCNAVH 117
>NLTP_PRUAV (Q9M5X8) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pru av 3) Length = 117 Score = 32.0 bits (71), Expect = 0.38 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 357 ASPSRCGVSVPYTISASVDCTKI 289 A P +CGV+VPY IS S +C + Sbjct: 94 ALPGKCGVNVPYKISPSTNCATV 116
>NLTP1_PRUDU (Q43017) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 357 ASPSRCGVSVPYTISASVDCTKI 289 A P +CGV++PY IS S +C + Sbjct: 94 ALPGKCGVNIPYQISPSTNCANV 116
>NLTP6_ARATH (Q9LDB4) Nonspecific lipid-transfer protein 6 precursor (LTP 6)| Length = 113 Score = 32.0 bits (71), Expect = 0.38 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS+CGV +PY S S DC I Sbjct: 92 PSKCGVDLPYKFSPSTDCDSI 112
>LYST_HUMAN (Q99698) Lysosomal trafficking regulator (Beige homolog)| Length = 3801 Score = 32.0 bits (71), Expect = 0.38 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 6/86 (6%) Frame = +2 Query: 59 VSSKGVNKQSNTDTKTDTTVSGQVELAQRTY---SSLSP---MENITEDLFMYMYICVCD 220 V +G S ++ + T V+L T +S SP +EN+T+ +Y IC+ + Sbjct: 1216 VEEEGYEADSESNPEDGETQDDGVDLKSETEGFSASSSPNDLLENLTQGEIIYPEICMLE 1275 Query: 221 LNLPSVDRWRYERL*WKHAFDQWILV 298 LNL S + + + L H F+ ++ + Sbjct: 1276 LNLLSASKAKLDVL--AHVFESFLKI 1299
>NLTP_PYRCO (Q9M5X6) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pyr c 3) Length = 115 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 360 QASPSRCGVSVPYTISASVDCTKI 289 ++ P +CGV+VPY IS S +C + Sbjct: 91 ESLPGKCGVNVPYKISTSTNCATV 114
>SCA_LILLO (Q9SW93) Stigma/stylar cysteine-rich adhesin precursor (Lipid| transfer protein) Length = 113 Score = 31.6 bits (70), Expect = 0.50 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGV++PY I DC K+ Sbjct: 92 PGKCGVNIPYPIRMQTDCNKV 112
>NLTP_MALDO (Q9M5X7) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Mal d 3) Length = 115 Score = 31.6 bits (70), Expect = 0.50 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +CGV+VPY IS S +C + Sbjct: 94 PGKCGVNVPYKISTSTNCATV 114
>NLTP1_LYCES (P93224) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 114 Score = 31.2 bits (69), Expect = 0.65 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS S DC+ + Sbjct: 93 PGVCGVNIPYKISPSTDCSTV 113
>NLTP6_GOSHI (O24418) Nonspecific lipid-transfer protein 6 precursor (LTP)| Length = 120 Score = 31.2 bits (69), Expect = 0.65 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P +C V +PY IS S+DC ++ Sbjct: 99 PGQCNVHIPYKISPSIDCKRV 119
>NLTPB_BRAOT (Q42642) Nonspecific lipid-transfer protein B precursor (LTP B)| (Wax-associated protein 9B) Length = 117 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS S +C + Sbjct: 96 PKACGVNIPYKISKSTNCNSV 116
>NLTP2_BRANA (Q42615) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 117 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS S +C + Sbjct: 96 PKACGVNIPYKISKSTNCNSV 116
>NLTP1_BRANA (Q42614) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS S +C + Sbjct: 96 PKACGVNIPYKISKSTNCNSV 116
>POLN_HEVPA (P33424) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -2 Query: 350 PPGAASASPTRSAPVSTAPRSTDRTRASIIAVHTSSDRRLV 228 PP A SPT SAP P RA I T+ RRL+ Sbjct: 741 PPPAPDPSPTLSAPARGEPAPGATARAPAITHQTARHRRLL 781
>NLTP2_ARATH (Q9S7I3) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS C V++PY ISAS +C + Sbjct: 97 PSACKVNIPYKISASTNCNTV 117
>NLTP2_LYCES (P27056) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 PS C V++PY IS S DC+ + Sbjct: 93 PSVCKVNIPYKISPSTDCSTV 113
>NLTP1_ARATH (Q42589) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS S +C + Sbjct: 97 PKACGVNIPYKISTSTNCKTV 117
>NLTPA_BRAOT (Q42641) Nonspecific lipid-transfer protein A precursor (LTP A)| (Wax-associated protein 9A) Length = 118 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGVSVP+ IS + +C + Sbjct: 97 PKACGVSVPFPISTNTNCNNV 117
>UL49_EHV1B (P28960) Tegument protein (Gene 11 protein)| Length = 304 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 353 PPPGAASASPTRSAPVSTAPRSTD 282 PPP + PTR+A ST PR D Sbjct: 134 PPPRVPTRPPTRAAATSTTPRQQD 157
>PEPT_LISMF (Q71YN8) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 410 Score = 29.3 bits (64), Expect = 2.5 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +2 Query: 74 VNKQSNTDTKTDTTVSGQVELAQRTYSSLSP--MENITEDLFMYM 202 V+ QSN ++K T GQ+ELA + L M+ +T D F Y+ Sbjct: 15 VDTQSNEESKACPTTPGQMELANILVTELKEIGMQEVTVDEFGYV 59
>NLTP3_BRANA (Q42616) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 28.9 bits (63), Expect = 3.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS + +C + Sbjct: 96 PKACGVNIPYKISKTTNCNSV 116
>NLTPD_BRAOT (Q43304) Nonspecific lipid-transfer protein D precursor (LTP D)| (Wax-associated protein 9D) Length = 118 Score = 28.9 bits (63), Expect = 3.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 351 PSRCGVSVPYTISASVDCTKI 289 P CGV++PY IS + +C + Sbjct: 97 PKACGVNIPYKISKTTNCNSV 117
>VKGC_BOVIN (Q07175) Vitamin K-dependent gamma-carboxylase (EC 6.4.-.-)| (Gamma-glutamyl carboxylase) (Vitamin K gamma glutamyl carboxylase) Length = 758 Score = 28.9 bits (63), Expect = 3.2 Identities = 29/109 (26%), Positives = 45/109 (41%) Frame = -2 Query: 341 AASASPTRSAPVSTAPRSTDRTRASIIAVHTSSDRRLVG*GHIHIYTYT*INPPLCSPWE 162 A SA P R APR +D+ + A TS R+ G + + +T + S WE Sbjct: 2 AVSARPAR------APRGSDKVKKDK-AAQTSGPRQGSRMGKLLGFEWTDV-----SSWE 49 Query: 161 RERSTYAEPALLGRSLLYRFLYQCLIVCSLPLRRHIREFAVRCTMGTXV 15 R + P ++RFL+ ++V +P R + R G V Sbjct: 50 RLVTLLNRPTDPAGLAVFRFLFGLMMVLDIPQERGLSSLDRRYLDGLEV 98
>IE63_EBV (Q04360) Transcriptional regulator IE63 homolog (Diffuse early| antigen) Length = 438 Score = 28.9 bits (63), Expect = 3.2 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -2 Query: 362 RRHPPPGAASASPTRSAPVSTAPRSTDRTRASIIAVHTSSDRRLVG 225 RRH PPGA + R+ V APRS R++ S+ R G Sbjct: 103 RRHLPPGARAPRAPRAPRVPRAPRSPRAPRSNRATRGPRSESRGAG 148
>UVRA_STRAW (Q829X3) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 1009 Score = 28.5 bits (62), Expect = 4.2 Identities = 28/112 (25%), Positives = 44/112 (39%), Gaps = 8/112 (7%) Frame = +1 Query: 16 T*VPMVQRTANSRMCLLKGSEQTIKH*YKNRYNSER----PSRAGSAYVLLSLSHGEHNG 183 T +P ++ LL G + I+ Y+NRY ER P +V S E + Sbjct: 338 TDIPFAGLPQRAKKALLYGHKTQIEVRYRNRYGRERVYTTPFEGAVPFVKRRHSEAESDA 397 Query: 184 GFIHVYVYM----CM*PQPTKRRSLEV*TAMMEARVRSVDLGAVDTGADRVG 327 YM C Q T+ + L + +ME + V ++ AD +G Sbjct: 398 SRERFEGYMREVPCPTCQGTRLKPLVLAVTVMEKSIAEVAAMSISDCADFLG 449
>VKGC_SHEEP (Q9GL59) Vitamin K-dependent gamma-carboxylase (EC 6.4.-.-)| (Gamma-glutamyl carboxylase) (Vitamin K gamma glutamyl carboxylase) Length = 758 Score = 28.5 bits (62), Expect = 4.2 Identities = 29/109 (26%), Positives = 44/109 (40%) Frame = -2 Query: 341 AASASPTRSAPVSTAPRSTDRTRASIIAVHTSSDRRLVG*GHIHIYTYT*INPPLCSPWE 162 A SA P R APR D+ + A TS R+ G + + +T + S WE Sbjct: 2 AVSARPAR------APRGPDKVKKDK-AAQTSGPRQGSQMGKLLGFEWTDV-----SSWE 49 Query: 161 RERSTYAEPALLGRSLLYRFLYQCLIVCSLPLRRHIREFAVRCTMGTXV 15 R + P ++RFL+ ++V +P R + R G V Sbjct: 50 RLVTLLNRPTDPASLAVFRFLFGLMMVLDIPQERGLSSLDRRYLDGLEV 98
>ROBO2_HUMAN (Q9HCK4) Roundabout homolog 2 precursor| Length = 1378 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 353 PPPGAASASPTRSAPVSTAPRSTDRTRA 270 P PG S+S T S+ ST PR T+ RA Sbjct: 1324 PSPGGHSSSGTASSKGSTGPRKTEVLRA 1351
>ZN278_HUMAN (Q9HBE1) Zinc finger protein 278 (POZ-, AT hook-, and zinc| finger-containing protein) (Zinc finger sarcoma gene protein) (BTB-POZ domain zinc finger transcription factor) (Protein kinase A RI-alpha subunit-associated protein) (Zinc finger and Length = 687 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 289 DLGAVDTGADRVGDADAAPGGG 354 D GA D G VG A AAPGGG Sbjct: 76 DGGAADGGPADVGGATAAPGGG 97
>TEGU_EBV (P03186) Large tegument protein| Length = 3149 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 353 PPPGAASASPTRSAPVSTAPRS 288 PP ASA+P +AP S AP S Sbjct: 331 PPSSPASAAPASAAPASAAPAS 352
>ROBO2_MOUSE (Q7TPD3) Roundabout homolog 2 precursor| Length = 1470 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 353 PPPGAASASPTRSAPVSTAPRSTDRTRAS 267 P PG S+S T S+ ST PR D R S Sbjct: 1418 PSPGGHSSSGTSSSKGSTGPRKADVLRGS 1446
>YOT7_CAEEL (P34653) Hypothetical protein ZK632.7| Length = 632 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 74 VNKQSNTDTKTDTTVSGQVELAQRTYSSLSPME 172 +N+Q DTK D+ + G + + +S+L P+E Sbjct: 214 INRQLAYDTKADSAIIGDIPHSVEHFSNLVPLE 246
>CSD_MYCPA (Q9KII6) Probable cysteine desulfurase (EC 2.8.1.7)| Length = 685 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 350 PPGAASASPTRSAPVSTAPRSTDRTRASIIAVHTS 246 PP AA +P SAP +TA S R A V++S Sbjct: 113 PPQAAPPAPRGSAPDATAATSAGRAAAGTSDVYSS 147
>BCA3_HUMAN (Q9NQ31) Proline-rich protein BCA3 (Breast cancer-associated gene 3| protein) (PKA-interacting protein) (AKIP1) Length = 210 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 77 NKQSNTDTKTDTTVSGQVELAQRTYSSLSPMENITEDLFMYMY 205 N Q KT G ++++ + P ENI++DL++ +Y Sbjct: 134 NGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVY 176
>NIA_BETVE (P27783) Nitrate reductase [NAD(P)H] (EC 1.7.1.2) (NR)| Length = 898 Score = 27.7 bits (60), Expect = 7.2 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = -1 Query: 198 YMNKSSVMFSMGEREEYVR*ASSTWPLTVVSVFVSVFDCLFTPFEETHTG 49 +MN SS MFSM E +++ A S W + V ++DC T F + H G Sbjct: 523 FMNTSSKMFSMSEVKKH-NSAESAW----IIVHGHIYDC--THFLKDHPG 565
>POLN_HEVBU (P29324) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -2 Query: 350 PPGAASASPTRSAPVSTAPRSTDRTRASIIAVHTSSDRRLV 228 PP A SP SAP P S A I T+ RRL+ Sbjct: 741 PPPAPDPSPPPSAPALAEPASGATAGAPAITHQTARHRRLL 781
>Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92)| Length = 279 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 182 PLCSPWERERSTYAEP 135 PLC+ W R R TYA P Sbjct: 214 PLCNGWPRPRETYAVP 229
>B3GT6_HUMAN (Q96L58) Beta-1,3-galactosyltransferase 6 (EC 2.4.1.134) (beta| 3GalT6) (Galactosylxylosylprotein 3-beta-galactosyltransferase) (UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) (Galactosyltransferase II) (GAG GalTII) Length = 329 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 365 GRRHPPPGAASASPTRSAPVSTAPRSTDR 279 GR PPP A A+ + V++APR+ +R Sbjct: 44 GRSPPPPAPARAAAFLAVLVASAPRAAER 72
>EXPA_DROME (Q07436) Protein expanded| Length = 1427 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 356 HPPPGAASASPTRSAPVSTAPRSTDRTRASIIAVHTS 246 HP P AA + + + TA T R + SI+ HTS Sbjct: 866 HPAPSAAGSMSSLKSEEVTARFITTRPQISILKAHTS 902 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,673,439 Number of Sequences: 219361 Number of extensions: 1092386 Number of successful extensions: 3766 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 3585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3758 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)