| Clone Name | rbaak4f01 |
|---|---|
| Clone Library Name | barley_pub |
>MRPD_BACPF (Q9RGZ2) Na(+)/H(+) antiporter subunit D (Multiple resistance and| pH homeostasis protein D) (Mrp complex subunit D) Length = 493 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 149 WYIWQFVINL*SMFGLPPRDGIKNKSHLNLAM*XLGLDYVYA 24 W W F I+ S+ G+PP G +K L LA L +Y+ A Sbjct: 368 WLAWMFFISAISLAGIPPLSGFFSKFALILAA-FLNENYIIA 408
>MRAY_THICR (Q31I62) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 361 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 126 YDKLPYVPGSGLYNLDCVALVGWSSGW 206 Y ++PY+PG G + C ALVG G+ Sbjct: 227 YLQIPYIPGVGELAIFCAALVGAGLGF 253
>MRAY_DESDG (Q313Q6) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 358 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 126 YDKLPYVPGSGLYNLDCVALVGWSSGW 206 Y ++PYVPG G + C AL+G G+ Sbjct: 224 YLQVPYVPGMGEVTVFCGALIGAGLGF 250
>RT15_HUMAN (P82914) 28S ribosomal protein S15, mitochondrial precursor (S15mt)| (MRP-S15) Length = 257 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -1 Query: 253 MLDAARWKSRRKPSKHQPDDHPTRATQSKLYKPDPG 146 +L AAR RKP++ + DD P +T K Y+ PG Sbjct: 46 LLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPG 81
>MRAY_PSEPK (Q88N79) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 126 YDKLPYVPGSGLYNLDCVALVGWSSGW 206 Y +PYVPGSG + C AL+G G+ Sbjct: 227 YLLIPYVPGSGELIVFCGALIGAGLGF 253
>MRAY_DESVH (Q728U5) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 358 Score = 27.3 bits (59), Expect = 9.7 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +3 Query: 78 VLYSISRRQSKH*SQI--YDKLPYVPGSGLYNLDCVALVGWSSGW 206 +++SI + H SQI Y ++PYVPG G + C ALVG G+ Sbjct: 207 IVFSIFIYVAGH-SQIAGYLQVPYVPGVGEVAVFCGALVGAGLGF 250
>SKI_MOUSE (Q60698) Ski oncogene (C-ski)| Length = 725 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 151 PGTYGSLS*ICDQCLDCRL 95 P Y S S C QCLDCRL Sbjct: 232 PELYSSPSAACIQCLDCRL 250
>SKI_HUMAN (P12755) Ski oncogene (C-ski)| Length = 728 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 151 PGTYGSLS*ICDQCLDCRL 95 P Y S S C QCLDCRL Sbjct: 234 PELYSSPSAACIQCLDCRL 252
>MIA40_USTMA (Q4P8D2) Intermembrane space import and assembly protein 40,| mitochondrial precursor (Mitochondrial import inner membrane translocase TIM40) Length = 247 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 141 YVPGSGLYNLDCVALVGWSSGWCLDGFRLLF 233 Y P +G N DC L G + G C + F+L F Sbjct: 138 YDPETGEINWDCPCLGGMAHGPCGEQFKLAF 168
>SKI_HORSE (Q9TUG2) Ski oncogene (C-ski)| Length = 730 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 151 PGTYGSLS*ICDQCLDCRL 95 P Y S S C QCLDCRL Sbjct: 234 PELYSSPSAACIQCLDCRL 252
>MRAY_PELLD (Q3B126) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 368 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 126 YDKLPYVPGSGLYNLDCVALVGWSSG--WCLDGFRLLFHLAASSIACGTAV 272 Y +P++PG G + C+A+V S G W +F S+A G+A+ Sbjct: 229 YLSIPFIPGGGEIAVVCMAIVMASVGFLWFNSNPAEIFMGDTGSLALGSAI 279
>MRAY_COXBU (Q83F26) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 361 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 126 YDKLPYVPGSGLYNLDCVALVGWSSGW 206 Y +PY+PG+G + C ALVG G+ Sbjct: 227 YLAIPYIPGAGEVVVFCSALVGAGLGF 253 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,508,093 Number of Sequences: 219361 Number of extensions: 698724 Number of successful extensions: 1543 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1543 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)