Clone Name | rbags9p21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1079_METJA (Q58479) Hypothetical protein MJ1079 | 32 | 0.58 | 2 | TWF1_XENTR (Q5I082) Twinfilin-1 | 28 | 8.3 | 3 | TWF1_XENLA (Q68F50) Twinfilin-1 | 28 | 8.3 |
---|
>Y1079_METJA (Q58479) Hypothetical protein MJ1079| Length = 397 Score = 31.6 bits (70), Expect = 0.58 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -2 Query: 230 AIF-IICSRSIAILELANCQVGVIRFILWSEFIFLSQIFVVLFCGMDAWVGQSLVCVSHG 54 AIF I+ S +IAI+ L N ++ FI F FLS +F ++FC + +G + + Sbjct: 300 AIFSILISSTIAIIILLNLSKYILLFIRKVNFKFLS-LFFIIFCSLVVIIGSYNTYLIYH 358 Query: 53 FLVDKTVI 30 +V T I Sbjct: 359 IIVYLTAI 366
>TWF1_XENTR (Q5I082) Twinfilin-1| Length = 350 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 47 PETHD*HKPNFAQPKHPSHRTTQRKFVKG 133 P+ H HK NFA+PK P+ + R+ ++G Sbjct: 314 PKQHA-HKQNFAKPKGPAGKRGIRRLIRG 341
>TWF1_XENLA (Q68F50) Twinfilin-1| Length = 350 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 47 PETHD*HKPNFAQPKHPSHRTTQRKFVKG 133 P+ H HK NFA+PK P+ + R+ ++G Sbjct: 314 PKQHA-HKQNFAKPKGPAGKRGIRRLIRG 341 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,196,655 Number of Sequences: 219361 Number of extensions: 701520 Number of successful extensions: 1799 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1798 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)