| Clone Name | rbags9l14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCP1_BRALA (P04569) Sarcoplasmic calcium-binding proteins I, III... | 33 | 0.76 | 2 | WAPA_BACSU (Q07833) Wall-associated protein precursor | 31 | 2.9 | 3 | PCLO_CHICK (Q9PU36) Protein piccolo (Aczonin) (Fragment) | 30 | 4.9 | 4 | SYA_MYCMO (Q6KHK5) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine-... | 30 | 6.5 |
|---|
>SCP1_BRALA (P04569) Sarcoplasmic calcium-binding proteins I, III, and IV (SCP| I, III, IV) Length = 185 Score = 33.1 bits (74), Expect = 0.76 Identities = 18/56 (32%), Positives = 34/56 (60%) Frame = -2 Query: 651 SKEVTKEKEDMEWEVVEKTKALSRTGRVEGAYKPTKLSLEDELKALQQKVDINSYD 484 +K+ + + ED E E++++ K +++ + YK + SLEDE + L+ + DIN D Sbjct: 21 NKDGSIQWEDFE-EMIKRYKEVNKGSLSDADYKSMQASLEDEWRDLKGRADINKDD 75
>WAPA_BACSU (Q07833) Wall-associated protein precursor| Length = 2334 Score = 31.2 bits (69), Expect = 2.9 Identities = 31/129 (24%), Positives = 60/129 (46%), Gaps = 5/129 (3%) Frame = +2 Query: 65 KRVYTYDSEKELEHPMIRNGGSTIYWPLDKEG-----SIRSD*KKTLGWTVNMLSPVATH 229 K YTYD +L + + NG S ++ DKEG +IR+ +T + +++ + Sbjct: 1652 KTTYTYDQADQLTNMTLSNGTSILH-SYDKEGNEVSKTIRAGADQTYKFEYDVMGKLVKT 1710 Query: 230 NDSYGSSLPKDPRPNSLLLVAEEAQSSDDDVSAISF*HLDSIPRNS*RNRKKKLLQSF*E 409 D G+ L + NS L + S + + ++S+ D + S N +K + ++ + Sbjct: 1711 TDPLGNVLASEYDANSNL---TKTISPNGNEVSLSYDGTDRVKSKS-YNGTEKYIFTYDK 1766 Query: 410 NPPLISMIN 436 N S++N Sbjct: 1767 NGNETSVVN 1775
>PCLO_CHICK (Q9PU36) Protein piccolo (Aczonin) (Fragment)| Length = 5120 Score = 30.4 bits (67), Expect = 4.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 340 TLGQHPKELMKKQEEEITPKLLRKSPTH*HDKR 438 T+ K+L+ K EE+ P+LL KS H DK+ Sbjct: 1148 TVSSDHKKLLSKSEEDKKPELLEKSTPHPKDKK 1180
>SYA_MYCMO (Q6KHK5) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 905 Score = 30.0 bits (66), Expect = 6.5 Identities = 18/68 (26%), Positives = 40/68 (58%) Frame = -2 Query: 645 EVTKEKEDMEWEVVEKTKALSRTGRVEGAYKPTKLSLEDELKALQQKVDINSYDYKRIPK 466 E++K K +E ++EK K+L + ++ ++ +L+++ + + + +D DYK++ K Sbjct: 732 EISKNKLVLE-NLIEKNKSLFQGYKMNFSWSK---NLDEQNEQITKHIDQARSDYKKLLK 787 Query: 465 QNENK*NK 442 +ENK K Sbjct: 788 NSENKLEK 795 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,309,425 Number of Sequences: 219361 Number of extensions: 1837443 Number of successful extensions: 4716 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4714 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)