| Clone Name | rbags9k04 |
|---|---|
| Clone Library Name | barley_pub |
>RR16_HORVU (P25875) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 110 bits (275), Expect = 4e-24 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 556 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS Sbjct: 33 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 85
>RR16_SACOF (Q6ENY4) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 109 bits (272), Expect = 1e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 556 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK+KERTLS Sbjct: 33 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKDKERTLS 85
>RR16_SACHY (Q6L3B4) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 109 bits (272), Expect = 1e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 556 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK+KERTLS Sbjct: 33 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKDKERTLS 85
>RR16_MAIZE (P27723) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 109 bits (272), Expect = 1e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 556 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK+KERTLS Sbjct: 33 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKDKERTLS 85
>RR16_WHEAT (Q95H63) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 108 bits (269), Expect = 2e-23 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 556 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKE TLS Sbjct: 33 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKESTLS 85
>RR16_ORYSA (P12151) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 107 bits (266), Expect = 5e-23 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 556 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTV DILRKAEFFKEKERTLS Sbjct: 33 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVSDILRKAEFFKEKERTLS 85
>RR16_ORYNI (Q6ENJ5) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 107 bits (266), Expect = 5e-23 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS 556 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTV DILRKAEFFKEKERTLS Sbjct: 33 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVSDILRKAEFFKEKERTLS 85
>RR16_PANGI (Q68S24) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 86.3 bits (212), Expect = 9e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK 577 LRKVGFYDPIKNQ+CLNVPAILYFLEKGAQPT TV DIL+KAE FK Sbjct: 33 LRKVGFYDPIKNQSCLNVPAILYFLEKGAQPTGTVRDILKKAEVFK 78
>RR16_TOBAC (P06374) Chloroplast 30S ribosomal protein S16| Length = 85 Score = 85.9 bits (211), Expect = 1e-16 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 LRKVGFYDPIKNQT LNVPAILYFLEKGAQPT TV DIL+KAE FKE Sbjct: 33 LRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKE 79
>RR16_SOLTU (P32087) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 85.1 bits (209), Expect = 2e-16 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L+KVGFYDPIKNQT LNVPAILYFLEKGAQPT TV DIL+KAE FKE Sbjct: 33 LQKVGFYDPIKNQTYLNVPAILYFLEKGAQPTETVQDILKKAEVFKE 79
>RR16_CALFE (Q7YJY6) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 85.1 bits (209), Expect = 2e-16 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 LRKVGFYDPI NQT LNVP ILYFLEKGAQPT TVYDIL+KAE FKE Sbjct: 33 LRKVGFYDPINNQTYLNVPLILYFLEKGAQPTGTVYDILKKAEVFKE 79
>RR16_NYMAL (Q6EW66) Chloroplast 30S ribosomal protein S16| Length = 86 Score = 84.7 bits (208), Expect = 3e-16 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 LRKVGFYDPIKNQT LNVPAILYFLEKGAQPT TV+DI +KAE FKE Sbjct: 33 LRKVGFYDPIKNQTYLNVPAILYFLEKGAQPTGTVHDISKKAEVFKE 79
>RR16_SPIOL (P28807) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 81.3 bits (199), Expect = 3e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L+KVGFYDPIK+QT LNVPAIL FLEKGAQPT TVYDIL++AE FKE Sbjct: 33 LQKVGFYDPIKSQTYLNVPAILDFLEKGAQPTETVYDILKRAEVFKE 79
>RR16_SILLA (Q589B0) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 81.3 bits (199), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L+KVGFYDPIKNQT LNVPAIL F++KGAQPT TVYDIL++AE FKE Sbjct: 33 LQKVGFYDPIKNQTYLNVPAILDFIQKGAQPTETVYDILKRAEVFKE 79
>RR16_AMBTC (Q70Y15) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 80.1 bits (196), Expect = 6e-15 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK 577 LRKVGFYDPIKNQT NVPAILYFLEKGAQPT TV+DI +KAE FK Sbjct: 33 LRKVGFYDPIKNQTYSNVPAILYFLEKGAQPTVTVHDISKKAEVFK 78
>RR16_SINAL (P10359) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 73.9 bits (180), Expect = 4e-13 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 LRKVGFYDPI NQT LN+PAIL FL+KGAQPTRTV+DI +KA F E Sbjct: 33 LRKVGFYDPITNQTYLNLPAILDFLKKGAQPTRTVHDISKKAGIFTE 79
>RR16_OENHO (Q9MTQ0) Chloroplast 30S ribosomal protein S16| Length = 88 Score = 73.6 bits (179), Expect = 6e-13 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L KVGFYDPI N+T L++P ILYFLEKGAQPT TVYDIL+KA F E Sbjct: 33 LWKVGFYDPINNKTYLDIPGILYFLEKGAQPTGTVYDILKKAGVFTE 79
>RR16_LOTJA (P58125) Chloroplast 30S ribosomal protein S16| Length = 80 Score = 73.2 bits (178), Expect = 8e-13 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 LRKVGFYDPIKNQT LN+P IL FLE+GAQPT TV DI +KA FF + Sbjct: 33 LRKVGFYDPIKNQTYLNIPVILNFLEQGAQPTGTVQDISKKAGFFMD 79
>RR16_ARATH (P56806) Chloroplast 30S ribosomal protein S16| Length = 79 Score = 67.0 bits (162), Expect = 5e-11 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L KVGFYDPI NQT LN+ AIL FL+KGAQPTRT +DI +KA F E Sbjct: 33 LSKVGFYDPITNQTFLNLSAILDFLKKGAQPTRTAHDISKKAGIFTE 79
>RR16_HUPLU (Q5SCW6) Chloroplast 30S ribosomal protein S16| Length = 84 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/47 (61%), Positives = 39/47 (82%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 +++VG YDPIK+QT N+P I+YF+E+GAQPT TV DIL+KAE F + Sbjct: 33 IQEVGSYDPIKDQTQXNMPTIVYFIERGAQPTETVKDILQKAEIFAQ 79
>RR16_CHAGL (Q8MA02) Chloroplast 30S ribosomal protein S16| Length = 83 Score = 54.7 bits (130), Expect = 3e-07 Identities = 24/50 (48%), Positives = 38/50 (76%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 L+++GFY+PIKN L+V I+ FL+ GA+PT TV+DIL K + F++ ++ Sbjct: 33 LKELGFYNPIKNSIQLDVQNIILFLKNGAKPTDTVFDILNKHQVFEQMKK 82
>RR16_ANTFO (Q85CF2) Chloroplast 30S ribosomal protein S16| Length = 84 Score = 53.5 bits (127), Expect = 6e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK 577 L +VGFY+ K+QT L++ AI+ + +GAQPT TVYDILRKA F+ Sbjct: 33 LEEVGFYNLRKDQTQLDILAIVNLIREGAQPTETVYDILRKAGIFE 78
>RR16_MESVI (Q9MUR5) Chloroplast 30S ribosomal protein S16| Length = 84 Score = 51.6 bits (122), Expect = 2e-06 Identities = 22/47 (46%), Positives = 37/47 (78%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L+++GFYDPI +T L+VP I+++L+ GAQ + TV ++L+KA+ F + Sbjct: 33 LKELGFYDPIAGKTQLDVPNIIFYLKAGAQTSETVGNLLQKAKVFNQ 79
>RS16_SYNY3 (P74410) 30S ribosomal protein S16| Length = 82 Score = 50.1 bits (118), Expect = 7e-06 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L ++GFY+P ++T L+VPAI+ L++GAQPT TV IL KA+ F++ Sbjct: 33 LEELGFYNPRTDETRLDVPAIVKRLKEGAQPTDTVRSILTKAQVFEQ 79
>RR16_PORPU (P51352) Chloroplast 30S ribosomal protein S16| Length = 82 Score = 45.1 bits (105), Expect = 2e-04 Identities = 20/48 (41%), Positives = 35/48 (72%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEK 571 + ++GFY+PI N+T +++ IL L++GAQ TRTV +IL +A+ ++ Sbjct: 33 IEELGFYNPITNETRIDIAKILKRLKQGAQTTRTVKNILNEAQIIAKE 80
>RS16_ANASP (Q8YVM2) 30S ribosomal protein S16| Length = 86 Score = 43.1 bits (100), Expect = 8e-04 Identities = 20/47 (42%), Positives = 33/47 (70%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L ++G+Y+P ++ L+VP I+ L++GAQPT TV IL+K F++ Sbjct: 33 LEELGYYNPRTDEVRLDVPGIVKRLQQGAQPTDTVRRILQKQNVFEQ 79
>RR16_CYAPA (P48139) Cyanelle 30S ribosomal protein S16| Length = 77 Score = 42.0 bits (97), Expect = 0.002 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + ++GFY+P N++ LN+ I +E+GAQPT TV IL KA Sbjct: 33 IEELGFYNPRTNESSLNIANIKRRIEQGAQPTNTVRYILAKA 74
>RR16_GALSU (P28521) Chloroplast 30S ribosomal protein S16| Length = 77 Score = 41.2 bits (95), Expect = 0.003 Identities = 17/43 (39%), Positives = 30/43 (69%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAE 586 + ++GF +P + LN+ I ++L GA+PT+TV+D+L KA+ Sbjct: 33 IEELGFMNPRTKEKYLNINKINHYLRLGAKPTKTVFDLLNKAK 75
>RS16_UREPA (Q9PPS1) 30S ribosomal protein S16| Length = 101 Score = 40.8 bits (94), Expect = 0.004 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 + +G YDP+ Q L AIL L+ GAQP+ TV +IL + +KE Sbjct: 36 IENLGHYDPVLGQVVLKKEAILAQLQNGAQPSETVKNILSQEGIWKE 82
>RS16_SYNEL (Q8DMS1) 30S ribosomal protein S16| Length = 83 Score = 40.8 bits (94), Expect = 0.004 Identities = 22/47 (46%), Positives = 27/47 (57%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 L ++GFYDPI N+ L AI L +GAQPT TV + KA E Sbjct: 33 LEELGFYDPIHNEVRLKEEAIKRRLAQGAQPTDTVRRLFVKANLLPE 79
>RR16_GUITH (O78423) Chloroplast 30S ribosomal protein S16| Length = 76 Score = 38.9 bits (89), Expect = 0.016 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEF 583 + ++GFY+P N+T +NV + L +G +PT TV ++L K F Sbjct: 33 IEELGFYNPCTNETHINVERVKVRLSQGVKPTSTVKNLLDKVIF 76
>RR16_PHATR (Q5D704) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 38.5 bits (88), Expect = 0.021 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAE 586 + ++G+Y PI Q +V I +L+ G +PT TV +LRKAE Sbjct: 33 IEELGYYSPITKQYKFDVEKIKKWLDFGVKPTETVSSLLRKAE 75
>RS16_THETH (P80379) 30S ribosomal protein S16| Length = 91 Score = 38.1 bits (87), Expect = 0.027 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = -1 Query: 714 LRKVGFYDPIKNQTC---LNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 + K+G+YDP K ++V Y+L GAQPT T +LR+A F+++ R Sbjct: 36 IEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAR 88
>RS16_THET8 (Q5SJH3) 30S ribosomal protein S16| Length = 88 Score = 38.1 bits (87), Expect = 0.027 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = -1 Query: 714 LRKVGFYDPIKNQTC---LNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 + K+G+YDP K ++V Y+L GAQPT T +LR+A F+++ R Sbjct: 33 IEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAR 85
>RS16_THET2 (P62238) 30S ribosomal protein S16| Length = 88 Score = 38.1 bits (87), Expect = 0.027 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = -1 Query: 714 LRKVGFYDPIKNQTC---LNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 + K+G+YDP K ++V Y+L GAQPT T +LR+A F+++ R Sbjct: 33 IEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAR 85
>RS16_THEAQ (O07348) 30S ribosomal protein S16| Length = 88 Score = 38.1 bits (87), Expect = 0.027 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = -1 Query: 714 LRKVGFYDPIKNQTC---LNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 + K+G+YDP K ++V Y+L GAQPT T +LR+A F+++ R Sbjct: 33 IEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAR 85
>RS16_MYCPE (Q8EWV0) 30S ribosomal protein S16| Length = 132 Score = 38.1 bits (87), Expect = 0.027 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 + KVG Y+P + +N L +L+KGAQP+ TV ++LR+ +K+ Sbjct: 33 IEKVGTYEPFEGVVNINEEIALSWLKKGAQPSDTVKNLLREQGVWKK 79
>RS16_PROMP (Q7TU65) 30S ribosomal protein S16| Length = 114 Score = 38.1 bits (87), Expect = 0.027 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 L+++GFY+P +T L+ A+ L +GAQPT V +L K ++K R Sbjct: 33 LQELGFYNPRTKETRLDTEALRIRLTQGAQPTDVVRTLLEKGGLLEKKVR 82
>RS16_MYCGA (Q9RDV4) 30S ribosomal protein S16| Length = 80 Score = 37.0 bits (84), Expect = 0.060 Identities = 19/44 (43%), Positives = 25/44 (56%) Frame = -1 Query: 705 VGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 +G DPI LN + +L+KGAQPT TV IL K +K+ Sbjct: 30 IGHIDPINGTNKLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQ 73
>RS16_LACJO (P62231) 30S ribosomal protein S16| Length = 90 Score = 36.6 bits (83), Expect = 0.078 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPIKN--QTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + +VG+Y+P+ N + L I +LEKGAQP+ TV +L KA Sbjct: 34 IEEVGYYNPLTNPDEVKLEEDKIFEWLEKGAQPSDTVRSLLSKA 77
>RS16_PROMM (Q7TV43) 30S ribosomal protein S16| Length = 122 Score = 36.6 bits (83), Expect = 0.078 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 L+++GFY+P +T L+ A+ L +GAQPT V +L K ++ R Sbjct: 33 LQELGFYNPRTKETRLDTEALRLRLSQGAQPTDAVRSLLEKGGLIEKTVR 82
>RR16_ODOSI (P49503) Chloroplast 30S ribosomal protein S16| Length = 79 Score = 36.2 bits (82), Expect = 0.10 Identities = 16/47 (34%), Positives = 31/47 (65%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 + +VG+Y+ I ++ +V I +L GA+PT+TV ++L+KA+ + Sbjct: 33 VEQVGYYNTITKESYFDVIKIKKWLNYGAKPTQTVLNLLKKAKIIDQ 79
>RS16_PROMA (Q7VAU5) 30S ribosomal protein S16| Length = 131 Score = 36.2 bits (82), Expect = 0.10 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 L+++GFY+P +T L+ A+ L +GAQPT V +L K ++ R Sbjct: 33 LQELGFYNPRTKETRLDTEALRLRLSQGAQPTDAVRSLLEKGGLLEKTIR 82
>RS16_STRP8 (P66448) 30S ribosomal protein S16| Length = 90 Score = 35.8 bits (81), Expect = 0.13 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + VG Y+P+ +NQ + +L +L KGAQP+ TV +IL KA Sbjct: 34 IETVGTYNPLVAENQITIKEDRVLEWLSKGAQPSDTVRNILSKA 77
>RS16_STRP6 (Q5XCR1) 30S ribosomal protein S16| Length = 90 Score = 35.8 bits (81), Expect = 0.13 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + VG Y+P+ +NQ + +L +L KGAQP+ TV +IL KA Sbjct: 34 IETVGTYNPLVAENQITIKEDRVLEWLSKGAQPSDTVRNILSKA 77
>RS16_STRP3 (P66447) 30S ribosomal protein S16| Length = 90 Score = 35.8 bits (81), Expect = 0.13 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + VG Y+P+ +NQ + +L +L KGAQP+ TV +IL KA Sbjct: 34 IETVGTYNPLVAENQITIKEDRVLEWLSKGAQPSDTVRNILSKA 77
>RS16_STRP1 (P66446) 30S ribosomal protein S16| Length = 90 Score = 35.8 bits (81), Expect = 0.13 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + VG Y+P+ +NQ + +L +L KGAQP+ TV +IL KA Sbjct: 34 IETVGTYNPLVAENQITIKEDRVLEWLSKGAQPSDTVRNILSKA 77
>RR16_GRATL (Q6B914) Chloroplast 30S ribosomal protein S16| Length = 78 Score = 35.8 bits (81), Expect = 0.13 Identities = 14/43 (32%), Positives = 28/43 (65%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAE 586 + ++GFY P+ N++ +N+ + + +GAQPT+ V I+ + E Sbjct: 33 IEEIGFYSPLNNKSKINLIQVKKRIYQGAQPTKKVQQIISQFE 75
>RS16_STRA5 (P66443) 30S ribosomal protein S16| Length = 90 Score = 35.4 bits (80), Expect = 0.17 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + VG Y+P+ +NQ + +L +L KGAQP+ TV ++L KA Sbjct: 34 IETVGTYNPLVAENQVTIKEERVLEWLSKGAQPSDTVRNLLSKA 77
>RS16_STRA3 (P66442) 30S ribosomal protein S16| Length = 90 Score = 35.4 bits (80), Expect = 0.17 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + VG Y+P+ +NQ + +L +L KGAQP+ TV ++L KA Sbjct: 34 IETVGTYNPLVAENQVTIKEERVLEWLSKGAQPSDTVRNLLSKA 77
>RS16_STRAW (Q82JW0) 30S ribosomal protein S16| Length = 142 Score = 35.4 bits (80), Expect = 0.17 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPA--ILYFLEKGAQPTRTVYDILRK 592 + ++G Y P++N + + V A + Y+L GAQPT V IL+K Sbjct: 34 IEEIGLYHPVQNPSRMEVDAERVAYWLGVGAQPTEPVLAILKK 76
>RS16_LACLA (Q9CFB2) 30S ribosomal protein S16| Length = 90 Score = 35.0 bits (79), Expect = 0.23 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 + VG Y+P+ + Q L +L +L KGAQP+ TV ++L KA K+ Sbjct: 34 IETVGTYNPLVTEEQVTLKEERVLEWLSKGAQPSDTVRNLLSKAGVMKK 82
>RS16_GEOSL (P62230) 30S ribosomal protein S16| Length = 95 Score = 35.0 bits (79), Expect = 0.23 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAI--LYFLEKGAQPTRTVYDILRKAEFFKE 574 + VG YDP +N + L +L KGAQPT TV IL+KA +++ Sbjct: 41 IENVGTYDPNQNPAAVKFEEAKTLEWLGKGAQPTDTVKQILKKAGIWEK 89
>RS16_STRMU (Q8DUN9) 30S ribosomal protein S16| Length = 91 Score = 34.7 bits (78), Expect = 0.30 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + VG Y+P+ +NQ L IL +L GAQP+ TV +IL KA Sbjct: 34 IETVGTYNPLVTENQVTLKEDRILEWLGNGAQPSDTVRNILSKA 77
>RS16_ENTFA (Q834F9) 30S ribosomal protein S16| Length = 91 Score = 34.3 bits (77), Expect = 0.39 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -1 Query: 714 LRKVGFYDPIKN--QTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 + VG Y+P+K+ + L +L +L KGAQP+ TV +IL K K+ Sbjct: 34 IETVGTYNPLKDPAEVVLKEDLVLDWLSKGAQPSDTVRNILSKEGVMKK 82
>RS16_SYNPX (Q7TTU5) 30S ribosomal protein S16| Length = 140 Score = 34.3 bits (77), Expect = 0.39 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKER 565 L+++GFY+P +T L+ AI L +GAQPT V +L + ++ R Sbjct: 33 LQELGFYNPRTKETRLDTEAIRERLGQGAQPTDVVRTLLERGGLIEKTIR 82
>SYWM_YEAST (P04803) Tryptophanyl-tRNA synthetase, mitochondrial (EC 6.1.1.2)| (Tryptophan--tRNA ligase) (TrpRS) Length = 379 Score = 34.3 bits (77), Expect = 0.39 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +3 Query: 18 KSKXMELHRALLSKH*TSKTSKERFYRP*KTLKWQNEQVRLNSTKVKK--KSDPNHDGQI 191 +S+ +EL R L K +K K+ F+ T+ Q ++V ST KK KSDPNHD I Sbjct: 199 QSQHLELTRHLAEKF--NKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKSDPNHDSVI 256 Query: 192 LL 197 L Sbjct: 257 FL 258
>RS16_THEMA (Q9X1Q2) 30S ribosomal protein S16| Length = 95 Score = 33.9 bits (76), Expect = 0.51 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -1 Query: 714 LRKVGFYDPIKN-QTCLNVPAILYFLEKGAQPTRTVYDILRK 592 + +G+Y+P+K + ++V + ++ KGAQP+ TV DI RK Sbjct: 33 IESLGYYNPLKEGEIKIDVERAVEWILKGAQPSDTVRDIFRK 74
>RS16_STRR6 (P66445) 30S ribosomal protein S16| Length = 90 Score = 33.9 bits (76), Expect = 0.51 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 + VG Y+P+ +NQ L +L +L GAQP+ TV +IL K K+ Sbjct: 34 IETVGTYNPLVAENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKK 82
>RS16_STRPN (P66444) 30S ribosomal protein S16| Length = 90 Score = 33.9 bits (76), Expect = 0.51 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -1 Query: 714 LRKVGFYDPI--KNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKE 574 + VG Y+P+ +NQ L +L +L GAQP+ TV +IL K K+ Sbjct: 34 IETVGTYNPLVAENQVTLKEDRVLAWLANGAQPSDTVRNILSKEGVLKK 82
>RS16_FUSNN (Q8RDV8) 30S ribosomal protein S16| Length = 87 Score = 33.9 bits (76), Expect = 0.51 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -1 Query: 705 VGFYDPIKN-QTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERT 562 +G Y P+++ + L IL +L+ GAQPTRTV IL KA + + E + Sbjct: 36 LGNYFPLEDSKVVLKEEEILNYLKNGAQPTRTVKSILVKAGLWAKFEES 84
>RS16_TREDE (P62239) 30S ribosomal protein S16| Length = 81 Score = 33.5 bits (75), Expect = 0.66 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = -1 Query: 708 KVGFYDPIKN---QTCLNVPAILYFLEKGAQPTRTVYDILRKAEF 583 +VG Y PI+ Q + + +L KGAQPT TV +L K EF Sbjct: 35 EVGIYHPIETAEKQISFDADKVRNWLGKGAQPTDTVRRLLNKKEF 79
>RS16_BACTN (Q9RQ15) 30S ribosomal protein S16| Length = 184 Score = 33.5 bits (75), Expect = 0.66 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = -1 Query: 714 LRKVGFYDPIKNQTC--LNVPAILYFLEKGAQPTRTVYDILRKAEFFKEK 571 + K+G Y+P N LN A L ++ KGAQP+ TV +IL + + +K Sbjct: 34 IEKIGTYNPNTNPATVDLNFDAALAWVLKGAQPSDTVRNILSREGVYMKK 83
>RS16_MYCMS (P62233) 30S ribosomal protein S16| Length = 108 Score = 33.1 bits (74), Expect = 0.87 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -1 Query: 705 VGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFK 577 VG ++P+K++ ++ L +L GAQPT TV +L K K Sbjct: 36 VGTFNPLKDEVKIDNELTLKWLNNGAQPTDTVRSLLSKQGILK 78
>RS16_STRLI (O86868) 30S ribosomal protein S16| Length = 139 Score = 32.3 bits (72), Expect = 1.5 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPA--ILYFLEKGAQPTRTVYDILRK 592 + ++G Y P N + + V A + Y+L GAQPT V IL+K Sbjct: 34 IEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKK 76
>RS16_STRCO (O69879) 30S ribosomal protein S16| Length = 139 Score = 32.3 bits (72), Expect = 1.5 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPA--ILYFLEKGAQPTRTVYDILRK 592 + ++G Y P N + + V A + Y+L GAQPT V IL+K Sbjct: 34 IEEIGKYHPTYNPSVMEVDAERVAYWLGVGAQPTEPVLAILKK 76
>RS16_PSEPK (Q88MV6) 30S ribosomal protein S16| Length = 83 Score = 32.0 bits (71), Expect = 1.9 Identities = 15/46 (32%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Frame = -1 Query: 714 LRKVGFYDPI----KNQTCLNVPAILYFLEKGAQPTRTVYDILRKA 589 + +VGF++PI + + +N + Y+L +GAQP+ V +L++A Sbjct: 33 VERVGFFNPIAAGAEVKLSVNQERVTYWLSQGAQPSERVAQLLKEA 78
>RS16_ONYPE (P62235) 30S ribosomal protein S16| Length = 87 Score = 31.6 bits (70), Expect = 2.5 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKAEF 583 L +G YD I + L+ + +L GAQPT+TV + +K++F Sbjct: 34 LEILGTYDTILDIVELDHNKVQKWLSNGAQPTKTVKKVFKKSKF 77
>RS16_BLOFL (Q7VQG0) 30S ribosomal protein S16| Length = 82 Score = 31.6 bits (70), Expect = 2.5 Identities = 13/44 (29%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -1 Query: 714 LRKVGFYDP----IKNQTCLNVPAILYFLEKGAQPTRTVYDILR 595 + ++GF++P IK + +N+ + Y+L GAQP+ V+ +++ Sbjct: 33 IERIGFFNPVELDIKKRLRVNLDRVRYWLSNGAQPSDRVFVLIK 76
>RR16_CYAME (Q85G24) Chloroplast 30S ribosomal protein S16| Length = 75 Score = 31.6 bits (70), Expect = 2.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTV 610 + +GFY+PI Q +N I L +GAQ T TV Sbjct: 33 IEDLGFYNPISKQCVINKERIKVRLSQGAQMTETV 67
>RS16_TREPR (Q8KTS4) 30S ribosomal protein S16| Length = 93 Score = 30.8 bits (68), Expect = 4.3 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRK 592 L +VG+Y+P ++ + + E+GA PTRTV +L + Sbjct: 33 LCRVGYYNPRLKSAHIDTVMLRLWTERGAAPTRTVARLLHR 73
>RS16_CAUCR (P58122) 30S ribosomal protein S16| Length = 165 Score = 30.8 bits (68), Expect = 4.3 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = -1 Query: 714 LRKVGFYDPI-----KNQTCLNVPAILYFLEKGAQPTRTV 610 + KVG Y+P+ N+ L V +I +L+KGAQPT V Sbjct: 33 IEKVGTYNPLLKKDDANRVTLKVESIQEWLKKGAQPTDRV 72
>RS16_THIFE (Q9L9C8) 30S ribosomal protein S16| Length = 86 Score = 30.4 bits (67), Expect = 5.6 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPA--ILYFLEKGAQPTRTVYDILRK 592 + ++GFY+PI L + Y+L +GAQP+ TV L+K Sbjct: 33 IERLGFYNPIGAVAELRIDKERAAYWLSQGAQPSDTVAGFLKK 75
>RS16_PORGI (Q7MT66) 30S ribosomal protein S16| Length = 192 Score = 30.4 bits (67), Expect = 5.6 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -1 Query: 714 LRKVGFYDPIKNQTC--LNVPAILYFLEKGAQPTRTVYDILRK 592 + ++G Y+P N LN LY++ GAQPT T +IL + Sbjct: 34 IERIGSYNPNTNPATIDLNFERALYWIGVGAQPTDTARNILSR 76
>RS16_SPIKU (P62237) 30S ribosomal protein S16| Length = 119 Score = 30.4 bits (67), Expect = 5.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 705 VGFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRK 592 +G Y+PI +N +L GAQPT TV ++L K Sbjct: 36 IGTYNPINGYVKINYDLAYKWLLTGAQPTDTVRNLLSK 73
>MTR1B_MOUSE (Q8CIQ6) Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin| receptor) Length = 364 Score = 30.0 bits (66), Expect = 7.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 175 LGSLFFFTLVEFNRTCSFCHLSVFH 101 +GS+F T + NR C CH + +H Sbjct: 125 IGSVFNITAIAINRYCCICHSTTYH 149
>RS16_CHLTE (Q8KD88) 30S ribosomal protein S16| Length = 134 Score = 29.6 bits (65), Expect = 9.6 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = -1 Query: 714 LRKVGFYDPIKNQTCLNVPA--ILYFLEKGAQPTRTVYDILRKAEFFKE---KERTLS 556 L +G Y+P + + + Y+L GAQPT TV+ ++R E K R LS Sbjct: 33 LEVLGHYNPTAKPHTVTIEKDRVAYWLNVGAQPTDTVHSLIRGTGLLHEMNLKRRGLS 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,104,878 Number of Sequences: 219361 Number of extensions: 1701595 Number of successful extensions: 2889 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 2850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2884 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7252940416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)