Clone Name | rbags9i23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VO01_VACCV (Q80HX1) Protein O1 | 30 | 4.6 |
---|
>VO01_VACCV (Q80HX1) Protein O1| Length = 666 Score = 30.4 bits (67), Expect = 4.6 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 487 VLNGRFTPPELTKTN*VVRPLGIFVCRFDEYFSSIT 594 +LN RF PPE+ +V+ L CR DEY S++ Sbjct: 55 ILNVRFFPPEIINVTDIVKALQ-NSCRVDEYLKSVS 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,886,951 Number of Sequences: 219361 Number of extensions: 1579338 Number of successful extensions: 3045 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3045 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)