Clone Name | rbags9h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EUTC_PSEAE (Q9HX02) Ethanolamine ammonia-lyase light chain (EC 4... | 30 | 7.2 | 2 | DYHC_ANTCR (P39057) Dynein beta chain, ciliary | 29 | 9.5 | 3 | CU005_HUMAN (Q9Y3R5) Protein C21orf5 | 29 | 9.5 |
---|
>EUTC_PSEAE (Q9HX02) Ethanolamine ammonia-lyase light chain (EC 4.3.1.7)| (Ethanolamine ammonia-lyase small subunit) Length = 273 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +2 Query: 275 FSWSPTMHHLSLVNIYRRHAVLIRLMNLSYSMLCHMLLN*GKGVCLYRL 421 F+W+P + L + YR +RL LSY M H LL + C +L Sbjct: 199 FTWAP---RVGLTDAYRNCISNVRLEGLSYGMAAHRLLYLMREACRRQL 244
>DYHC_ANTCR (P39057) Dynein beta chain, ciliary| Length = 4466 Score = 29.3 bits (64), Expect = 9.5 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 2 EARRAYLSIHCHFTTGIS----VTA*LWP**FQISLEIWSTY 115 EA +A +IHCHF TGI + WP +I +E TY Sbjct: 2727 EALKAKPNIHCHFATGIGDPKYMPCATWPELNKILVEALDTY 2768
>CU005_HUMAN (Q9Y3R5) Protein C21orf5| Length = 2298 Score = 29.3 bits (64), Expect = 9.5 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 296 HHLSLVNIYRRHAVLIRLMNLSYSMLCHMLLN*GKGVCLYRL--MAPIW 436 HH++ V ++ R L N+ ++CH LL+ KG L L + IW Sbjct: 891 HHVTCVELFYRLHCLAPTANICEDIICHALLDPDKGTRLEALFRFSVIW 939 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,059,670 Number of Sequences: 219361 Number of extensions: 1826390 Number of successful extensions: 4433 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4328 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)