Clone Name | rbags9e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | C97B2_SOYBN (O48921) Cytochrome P450 97B2 (EC 1.14.-.-) | 70 | 4e-12 | 2 | C97B3_ARATH (O23365) Cytochrome P450 97B3 (EC 1.14.-.-) | 66 | 8e-11 | 3 | GPA8_CAEEL (Q20907) Guanine nucleotide-binding protein alpha-8 s... | 30 | 6.6 |
---|
>C97B2_SOYBN (O48921) Cytochrome P450 97B2 (EC 1.14.-.-)| Length = 576 Score = 70.5 bits (171), Expect = 4e-12 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -3 Query: 668 LLLQKFDVELRGSPDEVEMVTGATIHTKNGLWCRLRKRT 552 +LLQ FDVEL+G+P+ VE+VTGATIHTKNG+WCRL+KR+ Sbjct: 535 MLLQNFDVELKGTPESVELVTGATIHTKNGMWCRLKKRS 573
>C97B3_ARATH (O23365) Cytochrome P450 97B3 (EC 1.14.-.-)| Length = 580 Score = 66.2 bits (160), Expect = 8e-11 Identities = 26/39 (66%), Positives = 36/39 (92%) Frame = -3 Query: 668 LLLQKFDVELRGSPDEVEMVTGATIHTKNGLWCRLRKRT 552 +L QKFDVELRG+P+ VE+V+GATIH KNG+WC+L++R+ Sbjct: 541 MLFQKFDVELRGTPESVELVSGATIHAKNGMWCKLKRRS 579
>GPA8_CAEEL (Q20907) Guanine nucleotide-binding protein alpha-8 subunit| Length = 364 Score = 30.0 bits (66), Expect = 6.6 Identities = 15/55 (27%), Positives = 32/55 (58%) Frame = -3 Query: 566 LRKRT*SAGIILHQKALLIVDFSRRLHALAGYKAGSCTWLHLFGALGASILCTTI 402 L+ R ++G+I Q +++ +F+ R+ + G +A WLH+F + A + T++ Sbjct: 186 LKSRVPTSGVI--QYKIMLKNFNFRIFDVGGQRAQRRKWLHVFDDVQAVLFITSL 238 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,246,552 Number of Sequences: 219361 Number of extensions: 1925159 Number of successful extensions: 3994 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3993 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)