Clone Name | rbah63p24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SWF1_ASPFU (Q4WN54) Palmitoyltransferase swf1 (EC 2.3.1.-) | 33 | 0.83 | 2 | CPSF2_ARATH (Q9LKF9) Cleavage and polyadenylation specificity fa... | 31 | 4.1 | 3 | BFA1_YEAST (P47113) Mitotic check point protein BFA1 (Cell cycle... | 30 | 5.4 |
---|
>SWF1_ASPFU (Q4WN54) Palmitoyltransferase swf1 (EC 2.3.1.-)| Length = 379 Score = 33.1 bits (74), Expect = 0.83 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +1 Query: 421 WQTNTADGDIYDLRGSLLQSRKTMSDQEEHQQKCKSWELTKSQVLFLTDG 570 W+ + ADG ++ S + ++ SD++ Q+ +W ++ +Q+L +TDG Sbjct: 268 WKEDVADGLVFKSTRSEIYGNQSHSDEDTPAQR--TWPVSSNQILVITDG 315
>CPSF2_ARATH (Q9LKF9) Cleavage and polyadenylation specificity factor, 100 kDa| subunit (CPSF 100 kDa subunit) Length = 739 Score = 30.8 bits (68), Expect = 4.1 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = -3 Query: 159 DVMKFQLQLSEKLMSSVILKKVSQNK 82 D+ +++QLSEKLMS+VI KK+ ++ Sbjct: 604 DLCAYKVQLSEKLMSNVIFKKLGDSE 629
>BFA1_YEAST (P47113) Mitotic check point protein BFA1 (Cell cycle arrest| protein BFA1) Length = 574 Score = 30.4 bits (67), Expect = 5.4 Identities = 18/69 (26%), Positives = 31/69 (44%) Frame = +1 Query: 385 SGVIYQTHTVVAWQTNTADGDIYDLRGSLLQSRKTMSDQEEHQQKCKSWELTKSQVLFLT 564 +G ++ T W AD D D+ Q + ++D +E Q K ++ L Sbjct: 60 TGTVFSNSTSAFWSNKQADDD-QDMEVD--QDDEFLNDFQEFQNKKDDFDDAIKTNFHLR 116 Query: 565 DGCKMGPWK 591 +GC+ GP+K Sbjct: 117 NGCRTGPFK 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,157,129 Number of Sequences: 219361 Number of extensions: 2202444 Number of successful extensions: 3866 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3864 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)