>ZDHC1_HUMAN (Q8WTX9) Probable palmitoyltransferase ZDHHC1 (EC 2.3.1.-) (Zinc|
           finger DHHC domain-containing protein 1) (DHHC-1) (Zinc
           finger protein 377) (DHHC-domain-containing
           cysteine-rich protein 1)
          Length = 485

 Score = 33.5 bits (75), Expect = 0.54
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +1

Query: 298 PADRAPWPQSRAASSPPLQRNWEEKGPLKVRSSWLLFS 411
           PA   P P  R  + PP+Q  W+ K PL  RS  LL +
Sbjct: 341 PASPDPTPGRRDCAGPPVQVEWDRKKPLPWRSPLLLLA 378


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 83,920,510
Number of Sequences: 219361
Number of extensions: 1558073
Number of successful extensions: 4043
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3899
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4043
length of database: 80,573,946
effective HSP length: 107
effective length of database: 57,102,319
effective search space used: 5881538857
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)