Clone Name | rbah63p09 |
---|---|
Clone Library Name | barley_pub |
>PNCB_VIBCH (Q9KN67) Nicotinate phosphoribosyltransferase (EC 2.4.2.11)| (NAPRTase) Length = 435 Score = 29.6 bits (65), Expect = 4.9 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 5/67 (7%) Frame = +2 Query: 314 FQMSPI-KLAHFWHILDQALISEKNGALLGQTNWLIPFHK----AYVTRFAVALFYTSKN 478 F + PI +AH W + QAL++E++ + WL F A + F N Sbjct: 220 FDLKPIGTIAHEWFMGHQALVNERDSQQVALERWLTAFDGMLAIAPTDTLTIDAFLNDFN 279 Query: 479 RH*KSYY 499 RH + Y Sbjct: 280 RHLANAY 286
>MYH10_RAT (Q9JLT0) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.9 bits (63), Expect = 8.3 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +1 Query: 367 INFRKERSTSRSDQLAHSVSQSICH 441 I+F+KER+T ++ ++V+Q +CH Sbjct: 359 ISFKKERNTDQASMPENTVAQKLCH 383
>MYH10_MOUSE (Q61879) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.9 bits (63), Expect = 8.3 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +1 Query: 367 INFRKERSTSRSDQLAHSVSQSICH 441 I+F+KER+T ++ ++V+Q +CH Sbjct: 359 ISFKKERNTDQASMPENTVAQKLCH 383
>MYH10_HUMAN (P35580) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.9 bits (63), Expect = 8.3 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +1 Query: 367 INFRKERSTSRSDQLAHSVSQSICH 441 I+F+KER+T ++ ++V+Q +CH Sbjct: 359 ISFKKERNTDQASMPENTVAQKLCH 383
>MYH10_BOVIN (Q27991) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.9 bits (63), Expect = 8.3 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +1 Query: 367 INFRKERSTSRSDQLAHSVSQSICH 441 I+F+KER+T ++ ++V+Q +CH Sbjct: 359 ISFKKERNTDQASMPENTVAQKLCH 383 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,681,799 Number of Sequences: 219361 Number of extensions: 1285788 Number of successful extensions: 2424 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2424 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)