Clone Name | rbah63l21 |
---|---|
Clone Library Name | barley_pub |
>FNDC3_MOUSE (Q8BX90) Fibronectin type-III domain-containing protein 3a| Length = 1134 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -3 Query: 228 PCYLCCIA--HTSIKRPWLYGVCKDINTDDIFYHLKIYSR 115 P L C+A H ++K W G K ++TD + YHL++ R Sbjct: 890 PPRLECVAFNHQNLKLKWGEGTPKTLSTDAVQYHLQMEDR 929
>FNDC3_HUMAN (Q9Y2H6) Fibronectin type-III domain-containing protein 3a| Length = 1134 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -3 Query: 228 PCYLCCIA--HTSIKRPWLYGVCKDINTDDIFYHLKI 124 P L C+A H ++K W G K ++TD I YHL++ Sbjct: 890 PPRLECVAFSHQNLKLKWGEGTPKTLSTDSIQYHLQM 926
>DPOL_HBVYW (P03156) P protein [Includes: DNA-directed DNA polymerase (EC| 2.7.7.7); RNA-directed DNA polymerase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 832 Score = 29.3 bits (64), Expect = 6.9 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +3 Query: 231 TKYTPIAK----QQDSTLSPNYIQTR-WLPLVWKKLCLYKMEDSFFASKC 365 TKY P+ K L +Y QTR +L +WK LYK E + AS C Sbjct: 120 TKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFC 169
>DPOL_HBVIA (P24024) P protein [Includes: DNA-directed DNA polymerase (EC| 2.7.7.7); RNA-directed DNA polymerase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 832 Score = 29.3 bits (64), Expect = 6.9 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +3 Query: 231 TKYTPIAK----QQDSTLSPNYIQTR-WLPLVWKKLCLYKMEDSFFASKC 365 TKY P+ K L +Y QTR +L +WK LYK E + AS C Sbjct: 120 TKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTHSASFC 169
>RGL2_MOUSE (Q61193) Ral guanine nucleotide dissociation stimulator-like 2| (RalGDS-like factor) (RAS-associated protein RAB2L) Length = 778 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 309 VWKKLC-LYKMEDSFFASKCVLMEMVRPQPTLVY*PKEQKAKR 434 V+ LC ++ ED++ S+ +LM+ V+PQP + P +KA R Sbjct: 380 VFSSLCQIFSEEDNYSQSRELLMQEVKPQPPVE--PHSKKAPR 420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,513,614 Number of Sequences: 219361 Number of extensions: 1533662 Number of successful extensions: 3209 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3209 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)