Clone Name | rbah63l14 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MSB2_YEAST (P32334) Protein MSB2 (Multicopy suppressor of bud em... | 30 | 2.6 | 2 | EXOC3_HUMAN (O60645) Exocyst complex component 3 (Exocyst comple... | 28 | 9.9 |
---|
>MSB2_YEAST (P32334) Protein MSB2 (Multicopy suppressor of bud emergence 2)| Length = 1306 Score = 30.0 bits (66), Expect = 2.6 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -3 Query: 305 RLRDKRLHSRESRSVVEEDDDAPIPSMQERWQSSETLERLMGVMLVCSR--LSSHGGKLE 132 ++ D + S SRS V + D P+PS R S+T L R +S+HG E Sbjct: 784 QVSDTSVPSTSSRSSVSQVSDTPVPSTSSRSSVSQTSSSLQPTTTSSQRFTISTHGALSE 843
>EXOC3_HUMAN (O60645) Exocyst complex component 3 (Exocyst complex component| Sec6) Length = 756 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 3 QKRTNLKRPEQQLEGRGEKFRERDQLAF 86 QKR + + PE++ EG + RE +QL F Sbjct: 623 QKRISFRSPEERKEGAEKMVREAEQLRF 650 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,453,615 Number of Sequences: 219361 Number of extensions: 930583 Number of successful extensions: 2410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2409 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)