Clone Name | rbah63l08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POLG_HCVVA (Q9QAX1) Genome polyprotein [Contains: Core protein p... | 29 | 7.5 | 2 | NING_BPH19 (O48427) Protein ninG | 29 | 9.7 | 3 | SPP1_SCHPO (O74508) Set1 complex component spp1 (Set1C component... | 29 | 9.7 |
---|
>POLG_HCVVA (Q9QAX1) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 29.3 bits (64), Expect = 7.5 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 106 ALQ*FSFTTTAPLPTDQNLLCFLLSAWGISSLPPKCPSRG 225 A+ FS T+PLPT +L ++ W S + P + G Sbjct: 1792 AMMAFSAALTSPLPTSTTILLNIMGGWLASQIAPAAGATG 1831
>NING_BPH19 (O48427) Protein ninG| Length = 201 Score = 28.9 bits (63), Expect = 9.7 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 69 KPQNRKCNLT-EWSAPIIQFYNYCSTSHGSK 158 KP RKC + EW P +CS HG+K Sbjct: 3 KPARRKCKICKEWFHPAFSNQWWCSPEHGTK 33
>SPP1_SCHPO (O74508) Set1 complex component spp1 (Set1C component spp1)| (COMPASS component spp1) (Complex proteins associated with set1 protein spp1) Length = 424 Score = 28.9 bits (63), Expect = 9.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 81 RKCNLTEWSAPIIQFYNYCSTSHG 152 RKC L E S P NYCS HG Sbjct: 177 RKCRLRECSNPTRPNSNYCSDKHG 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,416,047 Number of Sequences: 219361 Number of extensions: 1361394 Number of successful extensions: 3409 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3409 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)