Clone Name | rbah63l05 |
---|---|
Clone Library Name | barley_pub |
>Y15K_WDV (P06848) Hypothetical 15 kDa protein| Length = 131 Score = 32.3 bits (72), Expect = 1.8 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -1 Query: 489 GTHRFCHLLDALLP----PLQPMTSFMVVGGPFLFEIQLGGKVLFGTHLIWPIYS 337 G HR+ +L+ P PL P F F + L VL G HLIWP+YS Sbjct: 43 GLHRY-YLIRLFTPLIHSPLPPSAGFTF----FHLPLPLTSGVLVGHHLIWPVYS 92
>RPOA_LDVC (Q06502) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP1 Length = 3637 Score = 31.2 bits (69), Expect = 3.9 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = -2 Query: 674 SHMPAGGMDTVLSCDLPSSGGPQSAWYDFGGLLAVL-----LTEEALR--CKSCFAICFN 516 +H+ G + TV S GGP+ W+ F L+ +L ALR CK CF C Sbjct: 1057 NHLSVGLVGTVAGFVARSVGGPRRYWFYFLRLMVLLDLGLVFLAVALRGSCKKCFCKCVR 1116 Query: 515 S*GLSIGLMV 486 + + L V Sbjct: 1117 TASHEVQLRV 1126
>VDAC2_RABIT (P68003) Voltage-dependent anion-selective channel protein 2 (Outer| mitochondrial membrane protein porin 2) Length = 294 Score = 30.0 bits (66), Expect = 8.7 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 452 CPPCSR*LHLWWLVGHFCLKFN*AAKYYLEPT*SGRSIQLYLCSLLGI 309 C ++L W G C +F AAKY L+PT + S ++ SL+G+ Sbjct: 210 CEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT-ASISAKVNNSSLIGV 256
>VDAC2_PIG (Q9MZ15) Voltage-dependent anion-selective channel protein 2| Length = 294 Score = 30.0 bits (66), Expect = 8.7 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 452 CPPCSR*LHLWWLVGHFCLKFN*AAKYYLEPT*SGRSIQLYLCSLLGI 309 C ++L W G C +F AAKY L+PT + S ++ SL+G+ Sbjct: 210 CEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT-ASISAKVNNSSLIGV 256
>VDAC2_BOVIN (P68002) Voltage-dependent anion-selective channel protein 2 (Outer| mitochondrial membrane protein porin 2) Length = 294 Score = 30.0 bits (66), Expect = 8.7 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 452 CPPCSR*LHLWWLVGHFCLKFN*AAKYYLEPT*SGRSIQLYLCSLLGI 309 C ++L W G C +F AAKY L+PT + S ++ SL+G+ Sbjct: 210 CEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT-ASISAKVNNSSLIGV 256
>VDAC2_HUMAN (P45880) Voltage-dependent anion-selective channel protein 2| (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2) Length = 347 Score = 30.0 bits (66), Expect = 8.7 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 452 CPPCSR*LHLWWLVGHFCLKFN*AAKYYLEPT*SGRSIQLYLCSLLGI 309 C ++L W G C +F AAKY L+PT + S ++ SL+G+ Sbjct: 225 CEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT-ASISAKVNNSSLIGV 271 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 113,928,038 Number of Sequences: 219361 Number of extensions: 2489872 Number of successful extensions: 7029 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7024 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8579523872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)