Clone Name | rbah63k17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TILS_PROMA (Q7V9L9) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 30 | 3.7 | 2 | BART1_RAT (P55007) Protein BART-1 (Balloon angioplasty-responsiv... | 30 | 4.9 | 3 | FRU_DROME (Q8IN81) Sex determination protein fruitless | 30 | 6.4 | 4 | DMBT1_PIG (Q4A3R3) Deleted in malignant brain tumors 1 protein p... | 30 | 6.4 |
---|
>TILS_PROMA (Q7V9L9) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 336 Score = 30.4 bits (67), Expect = 3.7 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -2 Query: 526 NQLMPWHSSLMVSITVSQILIMSLKLRLWLG*YHRWSCYMLHVSLAW 386 + L+P+ SSL++S++ Q + LKL L L + W ++ H W Sbjct: 26 SNLLPYGSSLLISVSGGQDSMALLKLILDLQRIYEWKVHVWHGDHGW 72
>BART1_RAT (P55007) Protein BART-1 (Balloon angioplasty-responsive transcript| 1) Length = 235 Score = 30.0 bits (66), Expect = 4.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 235 RQRQLGGRGSWHADAAKE*RSTSIITKEGSTYK 137 R R+LGG GSW A R +++ KEG +K Sbjct: 42 RVRRLGGGGSWSLGAQIVARLAAVLGKEGGAFK 74
>FRU_DROME (Q8IN81) Sex determination protein fruitless| Length = 955 Score = 29.6 bits (65), Expect = 6.4 Identities = 21/61 (34%), Positives = 29/61 (47%) Frame = +1 Query: 190 LHLHASSLYHPTGAVSS*NYYDASGCALVSGSSCKNDQGPDFHSNLRMPAAMRSPMSVVK 369 LH H S HP+ + SS +Y ASG +GS + G S PA++ + S V Sbjct: 788 LHQHPPSATHPSHSQSSPHYPSASGAGAGAGSVSVSIAGSASGSATSAPASVAT--SAVS 845 Query: 370 P 372 P Sbjct: 846 P 846
>DMBT1_PIG (Q4A3R3) Deleted in malignant brain tumors 1 protein precursor| Length = 1204 Score = 29.6 bits (65), Expect = 6.4 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -3 Query: 441 GWGDIIVGLVICS---TCLWPGRSLGWFDNTHGTAHGCRHPEVAMEIRTLVIFT 289 G G I + V CS + LW R+ GWF +H C H E A I ++ FT Sbjct: 695 GSGPITLDDVACSGTESTLWQCRNRGWF------SHNCGHSEDAGVICSVPAFT 742 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,574,964 Number of Sequences: 219361 Number of extensions: 1684659 Number of successful extensions: 3705 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3705 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)