Clone Name | rbah63k10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RPS2_ARATH (Q42484) Disease resistance protein RPS2 (Resistance ... | 30 | 1.4 | 2 | RSP1_SCHPO (O13601) DnaJ-related protein rsp1 | 28 | 4.1 | 3 | RCNA_ECOLI (P76425) Nickel/cobalt efflux system rcnA | 28 | 5.4 | 4 | RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA | 28 | 5.4 | 5 | KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC ... | 28 | 7.0 | 6 | Y1684_METTH (O27719) Hypothetical protein MTH1684 | 28 | 7.0 |
---|
>RPS2_ARATH (Q42484) Disease resistance protein RPS2 (Resistance to Pseudomonas| syringae protein 2) Length = 909 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 38 IQLHRAGHPRPDRRKEMKGM*NQQRLASCTNV-ANQRVSVSNPDASHHEQL 187 I L + G PRPDR + K M + +A C N+ A ++ V + H +L Sbjct: 268 IDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWEL 318
>RSP1_SCHPO (O13601) DnaJ-related protein rsp1| Length = 494 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 22 NNG*HNSITPRGAPKARQAERNERYVKSAEVSILY 126 +NG NS + +P++ + NER+ ++E SI++ Sbjct: 237 SNGVENSSITKSSPRSSSSSNNERFKDTSEESIIF 271
>RCNA_ECOLI (P76425) Nickel/cobalt efflux system rcnA| Length = 274 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 164 DASHHEQLEHPKHRSSNGSVHSNLVQW*SNASELQNSNMLELCL--NMAPCP 313 D HH EH +++ ++ H+N ++ + E+ N +L L + PCP Sbjct: 137 DHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGLTGGLIPCP 188
>RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA| Length = 274 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 164 DASHHEQLEHPKHRSSNGSVHSNLVQW*SNASELQNSNMLELCL--NMAPCP 313 D HH EH +++ ++ H+N ++ + E+ N +L L + PCP Sbjct: 137 DHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGLTGGLIPCP 188
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +2 Query: 65 RPDRRKEMKGM*NQQRLASCTNVANQRVSV----SNPDASHHEQLEHPKHRS 208 R DRR+ G ++R T+ N+ V +P+ HH Q +H HRS Sbjct: 225 RSDRREG--GRKERERTVRSTHKQNRHDRVIELLDSPEQEHHHQHQHKSHRS 274
>Y1684_METTH (O27719) Hypothetical protein MTH1684| Length = 431 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 207 DLCFGCSSCSW*LASG-FDTDT 145 D CFGC C+W SG ++ DT Sbjct: 369 DRCFGCGVCAWSCPSGAYEMDT 390 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,033,589 Number of Sequences: 219361 Number of extensions: 982922 Number of successful extensions: 1881 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1881 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)