Clone Name | rbah63j09 |
---|---|
Clone Library Name | barley_pub |
>MRC2_HUMAN (Q9UBG0) Macrophage mannose receptor 2 precursor (Urokinase| receptor-associated protein) (Endocytic receptor 180) (CD280 antigen) Length = 1479 Score = 32.0 bits (71), Expect = 0.59 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = -2 Query: 308 TKLAGCSVKLSTDEHPPGRICYTAASPRGHMDVAWGVNRE 189 TKL G +S+ PP RI Y + P+G D AW RE Sbjct: 1236 TKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFRE 1275
>DEGU_BACSU (P13800) Transcriptional regulatory protein degU (Protease| production enhancer protein) Length = 229 Score = 28.9 bits (63), Expect = 5.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 340 HPHVCIVYINSPN*QVVPSNCQLMSIPQEEYATLLHHHED 221 HP V I+ IN PN V + QL+ + E +L H+D Sbjct: 49 HPDVVIMDINMPNVNGVEATKQLVELYPESKVIILSIHDD 88
>LPXB_BORPE (Q7VYB7) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 393 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 269 EHP-PGRICYTAASPRGHMDVAWGVNRERN 183 +HP PG C TAA +G VAW V N Sbjct: 243 QHPVPGLRCVTAAEGQGETPVAWSVMEASN 272
>LPXB_BORPA (Q7WA47) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 393 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 269 EHP-PGRICYTAASPRGHMDVAWGVNRERN 183 +HP PG C TAA +G VAW V N Sbjct: 243 QHPVPGLRCVTAAEGQGETPVAWSVMEASN 272
>LPXB_BORBR (Q7WJ81) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 393 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 269 EHP-PGRICYTAASPRGHMDVAWGVNRERN 183 +HP PG C TAA +G VAW V N Sbjct: 243 QHPVPGLRCVTAAEGQGETPVAWSVMEASN 272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,759,390 Number of Sequences: 219361 Number of extensions: 916080 Number of successful extensions: 1511 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1511 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)