Clone Name | rbah63j06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CP2E1_BOVIN (O18963) Cytochrome P450 2E1 (EC 1.14.14.1) (CYPIIE1) | 29 | 4.4 | 2 | SYH_UREPA (Q9PQK6) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histi... | 28 | 7.6 |
---|
>CP2E1_BOVIN (O18963) Cytochrome P450 2E1 (EC 1.14.14.1) (CYPIIE1)| Length = 495 Score = 29.3 bits (64), Expect = 4.4 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 212 TSLMFLSVTLYKFFVLSSP*VRQAYVFLKFLFYLPGKY 99 TSL +S+ F++LSSP ++ F +L YLPG + Sbjct: 195 TSLRLMSLFNENFYLLSSPWIQLYNNFPDYLQYLPGSH 232
>SYH_UREPA (Q9PQK6) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 420 Score = 28.5 bits (62), Expect = 7.6 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +1 Query: 169 TKNLYSVTDKNIR-LVYFP--IAHWLPMNVQYLVKIHHGLSLAMSVFVPCFRWDRSASG 336 +K +Y DK+ R L P A + V+ + ++H L L + F PCFR++R +G Sbjct: 63 SKEMYLFKDKSDRWLALRPEGTAGVIRAVVENKLLLNHPLPLKLMYFEPCFRYERPQAG 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,991,013 Number of Sequences: 219361 Number of extensions: 1215043 Number of successful extensions: 2635 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2635 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)