| Clone Name | rbah63j05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y5224_ARATH (Q94EG6) Protein At5g02240 | 43 | 3e-04 | 2 | Y2766_ARATH (O80934) Protein At2g37660, chloroplast precursor | 42 | 3e-04 | 3 | YM58_YEAST (Q03695) Hypothetical 35.0 kDa protein in PFK2-HFA1 i... | 32 | 0.46 | 4 | ATX4_ARATH (Q9SUE7) Histone-lysine N-methyltransferase ATX4 (EC ... | 28 | 6.7 |
|---|
>Y5224_ARATH (Q94EG6) Protein At5g02240| Length = 253 Score = 42.7 bits (99), Expect = 3e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -2 Query: 186 KPEGEGTPTXDFKALFSQVTARF 118 KPEG TPT DFKALFSQVT+RF Sbjct: 231 KPEGTSTPTKDFKALFSQVTSRF 253
>Y2766_ARATH (O80934) Protein At2g37660, chloroplast precursor| Length = 325 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 186 KPEGEGTPTXDFKALFSQVTARF 118 KPEG GTPT DFKALF+QVT +F Sbjct: 303 KPEGTGTPTKDFKALFTQVTTKF 325
>YM58_YEAST (Q03695) Hypothetical 35.0 kDa protein in PFK2-HFA1 intergenic| region Length = 313 Score = 32.0 bits (71), Expect = 0.46 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 152 SKRCSPRSQPGFESSVQEXTCISSXQGSYCMSV 54 S+ SPR++PG+ S C SS S C SV Sbjct: 225 SQPMSPRTRPGYRPSCSSSNCSSSSSSSACSSV 257
>ATX4_ARATH (Q9SUE7) Histone-lysine N-methyltransferase ATX4 (EC 2.1.1.43)| (Trithorax-homolog protein 4) (TRX-homolog protein 4) (Trithorax 4) (Protein SET DOMAIN GROUP 16) Length = 990 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 100 SWTDDSKPGCDLGEQRFEIXSRGALXFR 183 +W DSK CDL E+ E + + FR Sbjct: 123 NWRKDSKSDCDLEEEEIECRNEKVVSFR 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,238,205 Number of Sequences: 219361 Number of extensions: 306315 Number of successful extensions: 570 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)