Clone Name | rbah63j03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DUT_HHV6Z (P52541) Deoxyuridine 5'-triphosphate nucleotidohydrol... | 30 | 4.6 | 2 | CARB_STRCO (Q9KXR6) Carbamoyl-phosphate synthase large chain (EC... | 29 | 7.8 | 3 | CRBA2_BOVIN (P26444) Beta crystallin A2 (Beta-A2-crystallin) | 29 | 7.8 |
---|
>DUT_HHV6Z (P52541) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 376 Score = 29.6 bits (65), Expect = 4.6 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -3 Query: 295 PCYA-KVGVLLYRSPADPLEFHKDTKLKYLRMPNLTSINCFPSLTVLAQPL 146 PCY + ++ SP + FH T +++ PN +I CF ++ V A L Sbjct: 236 PCYIPEPWEMINLSPPESAVFHLKTCREFIIKPNSYTIQCFDAMYVCADEL 286
>CARB_STRCO (Q9KXR6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1102 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -3 Query: 490 WAVERILRTDEIAYEISGNQNVST-ALVEAFRHGDFRTRQIAE 365 W V+++ EIA EI+ ++ ++ L EA RHG F +QIAE Sbjct: 463 WFVDQLFLIKEIADEIAESRELTADLLTEAKRHG-FSDQQIAE 504
>CRBA2_BOVIN (P26444) Beta crystallin A2 (Beta-A2-crystallin)| Length = 196 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 310 SSKISQRNWAAYQHXXXXXXQFVLS*SHHA*KLR 411 S K+S W AYQ+ Q+VL HH+ + R Sbjct: 141 SLKVSSGAWVAYQYPGYRGYQYVLERDHHSGEFR 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,131,073 Number of Sequences: 219361 Number of extensions: 1375166 Number of successful extensions: 3467 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3452 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)