Clone Name | rbah63i24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YL32_CAEEL (P34423) Hypothetical protein F44B9.2 | 30 | 2.7 | 2 | ETF2_YMTV (Q9QB84) Early transcription factor 82 kDa subunit (VE... | 29 | 5.9 | 3 | DHCR7_RAT (Q9Z2Z8) 7-dehydrocholesterol reductase (EC 1.3.1.21) ... | 29 | 5.9 |
---|
>YL32_CAEEL (P34423) Hypothetical protein F44B9.2| Length = 503 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = -1 Query: 148 CLCT---SGLYILNLVCKWSELVYIISKAVFGMLFF 50 C+C SG+Y L + +W+EL Y +S+A ML F Sbjct: 356 CVCGEIFSGIYELTPIGQWTELEYKLSEAYIDMLAF 391
>ETF2_YMTV (Q9QB84) Early transcription factor 82 kDa subunit (VETF large| subunit) Length = 713 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +3 Query: 105 LHTRLSIYNPDVHKHCLHFTYYVHELRSIVSSSL 206 L T L+I+NP++HK + T + +++ +S+ L Sbjct: 41 LKTHLNIHNPEIHKRHILLTLKIRQVKGYLSNLL 74
>DHCR7_RAT (Q9Z2Z8) 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC| reductase) (Sterol delta-7-reductase) Length = 471 Score = 28.9 bits (63), Expect = 5.9 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = +3 Query: 72 ALEIMYTSSDHLHTRLSIYNPDVHKHCLHFTYYVHELRSIVSSSLT---DHLLLIFFIIL 242 A+E YTS+D L R + HF Y +L ++ L HLL F+II Sbjct: 373 AIECSYTSADGLKHRSKLLVSGFWGVARHFNY-TGDLMGSLAYCLACGGGHLLPYFYIIY 431 Query: 243 PSCARRHKCL 272 + H+CL Sbjct: 432 MTILLTHRCL 441 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,316,093 Number of Sequences: 219361 Number of extensions: 1002206 Number of successful extensions: 1770 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1770 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)