Clone Name | rbah63i23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDRP_TCV (P17460) Probable RNA-directed RNA polymerase (EC 2.7.7... | 31 | 1.3 | 2 | Y300_BUCBP (Q89AI6) Hypothetical UPF0053 protein bbp_300 | 30 | 2.9 | 3 | COS12_YEAST (P53053) Protein COS12 | 29 | 6.4 | 4 | YMC6_SCHPO (P05511) Hypothetical 91 kDa protein in cob intron | 28 | 8.4 |
---|
>RDRP_TCV (P17460) Probable RNA-directed RNA polymerase (EC 2.7.7.48)| (Protein p88) [Contains: Protein p28] Length = 775 Score = 31.2 bits (69), Expect = 1.3 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 2/67 (2%) Frame = -3 Query: 257 IAGLKRKQVGMCKTCHKPTHIQK--SMENSKKAGIWQVVVDIRILQQLRRLDSEVHVVIQ 84 ++G++R+ V + H P +K S ++A I+Q +D+ + +L R D+E+ ++ Sbjct: 340 LSGIRRRLVRLAGN-HTPVPREKYPSFYKGRRATIYQKALDLYMTCRLSRKDAELKTFVK 398 Query: 83 REKL*YT 63 EK+ +T Sbjct: 399 AEKINFT 405
>Y300_BUCBP (Q89AI6) Hypothetical UPF0053 protein bbp_300| Length = 519 Score = 30.0 bits (66), Expect = 2.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 197 IQKSMENSKKAGIWQVVVDIRILQQLRRLDSEVHVV 90 IQK+ N AG W +V+ I IL + LD+ + V Sbjct: 113 IQKNENNKHYAGFWTIVIQIVILDSIFSLDAIITAV 148
>COS12_YEAST (P53053) Protein COS12| Length = 380 Score = 28.9 bits (63), Expect = 6.4 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +2 Query: 164 QPFWNFPWIFVYGLACDKF---YTSQPASS 244 Q WN P +F G+ C+KF Y S P SS Sbjct: 324 QKIWNSPILFSDGIDCEKFFKWYFSTPVSS 353
>YMC6_SCHPO (P05511) Hypothetical 91 kDa protein in cob intron| Length = 807 Score = 28.5 bits (62), Expect = 8.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 257 IAGLKRKQVGMCKTCHKPTHIQKSMENSKK 168 +A RKQ+ +C++CH H K N K Sbjct: 776 MAKANRKQIPLCRSCHMKLHANKLTLNEDK 805 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,677,519 Number of Sequences: 219361 Number of extensions: 1284476 Number of successful extensions: 3278 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3277 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)