| Clone Name | rbah63i07 |
|---|---|
| Clone Library Name | barley_pub |
>CWC15_EMENI (Q5B020) Pre-mRNA-splicing factor cwc15| Length = 232 Score = 55.8 bits (133), Expect = 4e-08 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 420 DDVVFKNQARG-ETKTPKRFINDTIRSDFHRKFLHRYMK 307 DDVVFKNQARG E K K F+ND +RSDFH+KF+ +Y++ Sbjct: 194 DDVVFKNQARGTEDKRGKEFVNDLLRSDFHKKFMSKYVR 232
>CWC15_YARLI (Q6C0E6) Pre-mRNA-splicing factor CWC15| Length = 215 Score = 46.6 bits (109), Expect = 2e-05 Identities = 19/38 (50%), Positives = 30/38 (78%) Frame = -2 Query: 420 DDVVFKNQARGETKTPKRFINDTIRSDFHRKFLHRYMK 307 +DVVF+NQ + + + ++ND IRSDFHRKF++RY++ Sbjct: 179 EDVVFRNQTK-QARKEDSYVNDLIRSDFHRKFMNRYVR 215
>CWC15_SCHPO (P78794) Pre-mRNA-splicing factor cwc15 (Complexed with cdc5| protein 15) (Cell cycle control protein cwf15) Length = 265 Score = 43.9 bits (102), Expect = 2e-04 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = -2 Query: 420 DDVVFKNQARGETKTPKR-FINDTIRSDFHRKFLHRYM 310 +DVVF+N +G TP+ F+ND +RS+FH+KFL R++ Sbjct: 227 EDVVFRNTHKGVDDTPRPGFVNDMLRSEFHKKFLARFV 264
>CWC15_DEBHA (Q6BP48) Pre-mRNA-splicing factor CWC15| Length = 226 Score = 35.0 bits (79), Expect = 0.072 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 420 DDVVFKNQARGETKTPKRFINDTIRSDFHRKFLHRYMK 307 D FK Q + F NDT+ S+FH+ FL +Y++ Sbjct: 189 DSTAFKKQNSQNKNDDETFTNDTLNSEFHQNFLTKYIR 226
>CWC15_CANGA (Q6FVL2) Pre-mRNA-splicing factor CWC15| Length = 143 Score = 34.7 bits (78), Expect = 0.094 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = -2 Query: 393 RGETKTPKRFINDTIRSDFHRKFLHRYMK 307 R + P++F NDT+RS H++FL+R++K Sbjct: 115 RKKVVKPEKFTNDTVRSQKHKEFLNRFVK 143
>HIS5_CLOAB (Q97KI0) Imidazole glycerol phosphate synthase subunit hisH (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) Length = 203 Score = 31.2 bits (69), Expect = 1.0 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = +1 Query: 112 GHSKASVIYKQWVLFCTLRNRVNISSY---DNKDITVMSYKSMFGIQKH 249 G SK S +Y + L ++ N+++Y K V+SYK++FGIQ H Sbjct: 136 GVSKGSYVYFVHSYYAELADKNNLNAYCDYGTKLPAVVSYKNIFGIQFH 184
>CWC15_YEAST (Q03772) Pre-mRNA-splicing factor CWC15 (Complexed with CEF1| protein 15) Length = 175 Score = 30.0 bits (66), Expect = 2.3 Identities = 9/25 (36%), Positives = 20/25 (80%) Frame = -2 Query: 381 KTPKRFINDTIRSDFHRKFLHRYMK 307 K+ +IND +S++H++FLH++++ Sbjct: 151 KSASGYINDMTKSEYHQEFLHKHVR 175
>ENP1_BOVIN (O18956) Ectonucleoside triphosphate diphosphohydrolase 1 (EC| 3.6.1.5) (NTPDase1) (Ecto-ATP diphosphohydrolase) (ATPDase) (Lymphoid cell activation antigen) (CD39 antigen) (Ecto-apyrase) Length = 513 Score = 28.9 bits (63), Expect = 5.2 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Frame = +1 Query: 94 VIERSWGHSKASVIYKQWVL---FCTLRNRVNISSYDNKDITVMSYKSMFGI-QKHHRLF 261 +I HS+ K VL FCT R+ +N S Y DI + + Q +LF Sbjct: 276 IIHEPCFHSRYMRKIKMSVLNEGFCTKRHELNSSFYPLVDIEIRGAGNFQRCRQSIIQLF 335 Query: 262 QHAYCPYN 285 +YCPY+ Sbjct: 336 NTSYCPYS 343
>ZN683_HUMAN (Q8IZ20) Zinc finger protein 683| Length = 509 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -1 Query: 388 RDQDTETVHQRHHQK*FPPQVSA*VHEMMLLYALCCMDSMHAG 260 R + T+ +H + H + PQ VH + L +L C+ H G Sbjct: 417 RSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQG 459
>HRCA_CHLMU (P54306) Heat-inducible transcription repressor hrcA| Length = 392 Score = 28.9 bits (63), Expect = 5.2 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = -3 Query: 248 CFCIPNIDLYDITVISLLSYDDMFTLFLRVQKRTHCLYITDALL*PQDLSITSIYYLNSF 69 CF P + +T I L+S DD+ +F V TD L P+ L S+ + SF Sbjct: 137 CFSSPRFESDSVTNIQLVSIDDLRVVF--VLSTEFGQLFTDVLWLPEQLPENSLKRIESF 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,043,007 Number of Sequences: 219361 Number of extensions: 1182287 Number of successful extensions: 2372 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2369 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)