Clone Name | rbah63h21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EGL44_CAEEL (Q19849) Transcription enhancer factor-like protein ... | 32 | 0.74 | 2 | ACDA1_ARCFU (O29165) Acetyl-CoA decarbonylase/synthase complex a... | 30 | 2.8 |
---|
>EGL44_CAEEL (Q19849) Transcription enhancer factor-like protein egl-44| (Egg-laying defective protein 44) Length = 465 Score = 32.0 bits (71), Expect = 0.74 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +3 Query: 240 FPEKTGKLLRKLKEASXSKH----KSCWLEMTQSSDVNNC 347 F EK KLLR+L E S K CW + S DV NC Sbjct: 299 FYEKYPKLLRELFEKSEKKDVFFLAKCWANINVSDDVQNC 338
>ACDA1_ARCFU (O29165) Acetyl-CoA decarbonylase/synthase complex alpha subunit 1| (EC 1.2.99.2) (ACDS complex alpha subunit 1) (ACDS complex carbon monoxide dehydrogenase 1) (ACDS CODH 1) Length = 802 Score = 30.0 bits (66), Expect = 2.8 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = +3 Query: 216 KQPGLFPCFPEKTGKLLRKLKEASXSKH----KSCWLEMTQS--SDVNNCSRC 356 K PG+F PEK G++ + EA KH K + E ++ ++N C++C Sbjct: 356 KLPGVFLPIPEKVGQVAPLVAEAIFKKHGGERKYKFFESDEALMEEINKCTQC 408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,015,686 Number of Sequences: 219361 Number of extensions: 1033303 Number of successful extensions: 2007 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2006 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)