Clone Name | rbah63h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GSA_CORGL (Q8NT73) Glutamate-1-semialdehyde 2,1-aminomutase (EC ... | 30 | 3.2 | 2 | PRIM_NEIMB (P57029) DNA primase (EC 2.7.7.-) | 29 | 5.4 | 3 | PRIM_NEIMA (P57028) DNA primase (EC 2.7.7.-) | 29 | 5.4 |
---|
>GSA_CORGL (Q8NT73) Glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8)| (GSA) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) Length = 437 Score = 29.6 bits (65), Expect = 3.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 399 SSNFPTVLFVKSIGRLFSDRKSAPIFRLEPIY 304 +SN ++ F + G FSD K+A IFR P + Sbjct: 357 ASNMLSIRFAEGEGHNFSDMKAADIFRFAPFF 388
>PRIM_NEIMB (P57029) DNA primase (EC 2.7.7.-)| Length = 590 Score = 28.9 bits (63), Expect = 5.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 220 AIPKISDNVMLSYKFAPAQHEPDPGVSSTRKFQ 122 A+P++ D+ L + F P +H+PD + + K Q Sbjct: 321 ALPQLKDDKSLHFLFLPEEHDPDSYIRAYGKAQ 353
>PRIM_NEIMA (P57028) DNA primase (EC 2.7.7.-)| Length = 590 Score = 28.9 bits (63), Expect = 5.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 220 AIPKISDNVMLSYKFAPAQHEPDPGVSSTRKFQ 122 A+P++ D+ L + F P +H+PD + + K Q Sbjct: 321 ALPQLKDDKSLHFLFLPEEHDPDSYIRAYGKAQ 353 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,842,258 Number of Sequences: 219361 Number of extensions: 1079736 Number of successful extensions: 2121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2121 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)