Clone Name | rbah63h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FA29A_HUMAN (Q7Z4H7) Protein FAM29A | 29 | 3.7 | 2 | FBPB2_HAEIN (P71338) Iron(III)-transport system permease protein... | 28 | 8.3 | 3 | RPOC_LACJO (Q74L94) DNA-directed RNA polymerase beta' chain (EC ... | 28 | 8.3 |
---|
>FA29A_HUMAN (Q7Z4H7) Protein FAM29A| Length = 955 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 46 CTDPTDQMDSVQAEKHTREWFYKL*GFCTGSAP 144 C P DQ + KH EW ++ G C S P Sbjct: 77 CWPPFDQKSDTEFRKHCCEWIKRISGECGSSFP 109
>FBPB2_HAEIN (P71338) Iron(III)-transport system permease protein fbpB 2| Length = 506 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 228 EFFFRGKENKSASGETVGRPFLL 160 E FFRGK+ SG+ V RP+L+ Sbjct: 235 EIFFRGKQTLYHSGKGVTRPYLV 257
>RPOC_LACJO (Q74L94) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1224 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +2 Query: 35 GTVSVQTQQIKWTQFKRKNTRGSGSTNCEDFVQAVPRRNHRI---NKNGRPTVS 187 GTV+ Q+ TQ +N G D Q +PR N GR T+S Sbjct: 921 GTVAAQSIGEPGTQLTMRNFHNGGVAGAADITQGLPRVQELFEARNPKGRATIS 974 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,857,062 Number of Sequences: 219361 Number of extensions: 705169 Number of successful extensions: 1856 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1856 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)