| Clone Name | rbah62p18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APLP_DROME (Q9V496) Apolipophorins precursor (Retinoid- and fatt... | 32 | 1.9 | 2 | MTA_THECR (P52721) Metallothionein A (MT-A) | 30 | 5.5 | 3 | POMT2_MOUSE (Q8BGQ4) Protein O-mannosyl-transferase 2 (EC 2.4.1.... | 30 | 7.2 | 4 | MT_ZOAVI (P52728) Metallothionein (MT) | 30 | 9.4 |
|---|
>APLP_DROME (Q9V496) Apolipophorins precursor (Retinoid- and fatty acid-binding| glycoprotein) [Contains: Apolipophorin-2 (Apolipophorin II) (ApoL2); Apolipophorin-1 (Apolipophorin I) (ApoL1)] Length = 3351 Score = 32.0 bits (71), Expect = 1.9 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%) Frame = -1 Query: 369 ALRSRILLWARWVNAEIKFRTRPTHLYMFSGEWLLM-HLHMGVHVCVMCGVNFAVPLHQ* 193 + RS IL N ++ F + + ++F ++ L H+ G H+ G+NFA P + Sbjct: 2752 SFRSSILNCLLNENWDVVFNKKLLYSWIFFNDFELRGHVVDGKHIFTFDGLNFAYPGNCK 2811 Query: 192 RIILP*GMDNPESLVRTLVNVSIKSL 115 I+ +DN +++ L N +KS+ Sbjct: 2812 YILAQDSVDNNFTIIGQLTNGKLKSI 2837
>MTA_THECR (P52721) Metallothionein A (MT-A)| Length = 60 Score = 30.4 bits (67), Expect = 5.5 Identities = 21/44 (47%), Positives = 25/44 (56%) Frame = -1 Query: 600 SQESTCLRCLRPSKKCIPDSLTKWKRS*CSICCPSGITCKCIAG 469 S+ TC +C S KC S T K+S C CCPSG T KC +G Sbjct: 7 SKTGTC-KC-GDSCKCTNCSCTTCKKS-CCPCCPSGCT-KCASG 46
>POMT2_MOUSE (Q8BGQ4) Protein O-mannosyl-transferase 2 (EC 2.4.1.109)| (Dolichyl-phosphate-mannose--protein mannosyltransferase 2) Length = 820 Score = 30.0 bits (66), Expect = 7.2 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +1 Query: 223 TTHNAYMHSHVQMHQQPLTRKHIQMSG 303 TT N +HSH H+ PLTRKH Q++G Sbjct: 489 TTRN--LHSHY--HEAPLTRKHYQVTG 511
>MT_ZOAVI (P52728) Metallothionein (MT)| Length = 60 Score = 29.6 bits (65), Expect = 9.4 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = -1 Query: 564 SKKCIPDSLTKWKRS*CSICCPSGITCKCIAG 469 S KC S T K+S C CCPSG T KC +G Sbjct: 17 SCKCTNCSCTTCKKS-CCPCCPSGCT-KCASG 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,477,423 Number of Sequences: 219361 Number of extensions: 2200309 Number of successful extensions: 4992 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4991 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)