Clone Name | rbah62p06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ASR2_LYCES (P37219) Abscisic stress ripening protein 2 | 31 | 2.4 |
---|
>ASR2_LYCES (P37219) Abscisic stress ripening protein 2| Length = 114 Score = 31.2 bits (69), Expect = 2.4 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = -2 Query: 488 LYEKHEAXKDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXHXXKQDXKEAKEASGXXKHHH 309 L+EKH+A KDP H K KE KE G HHH Sbjct: 53 LHEKHKAKKDPEHAHKHKIEEEIMAVAAVGAGGFAFHEHHQKKDAKKEKKEVEGGHHHHH 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,102,519 Number of Sequences: 219361 Number of extensions: 635883 Number of successful extensions: 1605 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1604 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)