Clone Name | rbah63e07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UREE_RHOS4 (Q3J156) Urease accessory protein ureE | 29 | 3.7 | 2 | ENPL_CATRO (P35016) Endoplasmin homolog precursor (GRP94 homolog) | 28 | 8.3 | 3 | ENPL_ARATH (Q9STX5) Endoplasmin homolog precursor (GRP94 homolog... | 28 | 8.3 |
---|
>UREE_RHOS4 (Q3J156) Urease accessory protein ureE| Length = 182 Score = 29.3 bits (64), Expect = 3.7 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 394 HDRGQEQGAPHLDHALRHVHRQGRPLQDHLQDA 296 HD G QG H DH HVH +P +D DA Sbjct: 148 HDHGPAQGHGH-DHPHVHVHISHKPDEDETPDA 179
>ENPL_CATRO (P35016) Endoplasmin homolog precursor (GRP94 homolog)| Length = 817 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 266 ETGKVLPSPVGVLKVILEGSSLSMNMSQSVIQMRSSL 376 E ++LP + LK +++ +L +N+S+ ++Q SSL Sbjct: 432 EFDELLPKYLNFLKGLVDSDTLPLNVSREMLQQHSSL 468
>ENPL_ARATH (Q9STX5) Endoplasmin homolog precursor (GRP94 homolog) (Protein| SHEPHERD) (HSP90-like protein 7) Length = 823 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 266 ETGKVLPSPVGVLKVILEGSSLSMNMSQSVIQMRSSL 376 E ++LP + LK +++ +L +N+S+ ++Q SSL Sbjct: 428 EFDELLPKYLSFLKGLVDSDTLPLNVSREMLQQHSSL 464 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,813,510 Number of Sequences: 219361 Number of extensions: 620939 Number of successful extensions: 1541 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1541 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)