| Clone Name | rbah62n07 |
|---|---|
| Clone Library Name | barley_pub |
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESGKA 216 RQVQ SFIAFRPPGCEESGKA Sbjct: 153 RQVQCVSFIAFRPPGCEESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESGKA 216 RQVQ SFIAFRPPGCEESGKA Sbjct: 154 RQVQCVSFIAFRPPGCEESGKA 175
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 43.1 bits (100), Expect = 2e-04 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESGKA 216 RQVQ SFIAF+PPGCEESGKA Sbjct: 92 RQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 42.0 bits (97), Expect = 4e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESGKA 216 RQVQ SFIAF+PPGC+ESGKA Sbjct: 153 RQVQCVSFIAFKPPGCQESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 40.8 bits (94), Expect = 0.001 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESGKA 216 RQVQ SFIA +PPGCEESGKA Sbjct: 154 RQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESG 222 RQVQ SFIA++PPGCEESG Sbjct: 154 RQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESG 222 RQVQ SFIA++PPGCEESG Sbjct: 154 RQVQLISFIAYKPPGCEESG 173
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 30.8 bits (68), Expect = 0.93 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 281 RQVQXXSFIAFRPPGCEESG 222 RQVQ SFIA+ PGCEESG Sbjct: 152 RQVQLISFIAYN-PGCEESG 170
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 Query: 281 RQVQXXSFIAFRPPG 237 RQVQ SFIAF+PPG Sbjct: 165 RQVQCVSFIAFKPPG 179
>MNN1_YEAST (P39106) Alpha-1,3-mannosyltransferase MNN1 (EC 2.4.1.-)| Length = 762 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -2 Query: 124 NFLXYDLFMYEHRLWSIYAYVNSSTAYTYTTPVPXL 17 NF YD F +EH++ + ++N+ T T+ VP + Sbjct: 235 NFKKYDQFEFEHKM---FPFINNFTTETFHEMVPKI 267
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 281 RQVQXXSFIAFRPPG 237 RQVQ SFIA++PPG Sbjct: 167 RQVQIISFIAYKPPG 181 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,535,003 Number of Sequences: 219361 Number of extensions: 475096 Number of successful extensions: 747 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)