Clone Name | rbah62m23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UL63_HCMVA (P16820) Hypothetical protein UL63 | 30 | 2.1 | 2 | AMGO2_PONPY (Q5R7M3) Amphoterin-induced protein 2 precursor (AMI... | 29 | 2.8 | 3 | AMGO2_HUMAN (Q86SJ2) Amphoterin-induced protein 2 precursor (AMI... | 29 | 2.8 | 4 | ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-) | 29 | 3.7 |
---|
>UL63_HCMVA (P16820) Hypothetical protein UL63| Length = 129 Score = 29.6 bits (65), Expect = 2.1 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 8/63 (12%) Frame = -2 Query: 180 HCFGFSF-SIYLSYLFLRICVCPCSC-------TNMARENMLXCECCRWLCICTYA*YXT 25 H FG S+Y++Y++ +C C C + R N + C LC T++ T Sbjct: 48 HLFGKKLISLYVTYIYYTLCTPNCRCCIRRKNSPYLYRLNFCLIDTCLELCPPTFSLCIT 107 Query: 24 IIC 16 IC Sbjct: 108 KIC 110
>AMGO2_PONPY (Q5R7M3) Amphoterin-induced protein 2 precursor (AMIGO-2)| Length = 522 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 159 SIYLSYLFLRICVCPCSCTNMARENML 79 SI L L+L + CPC C ++NML Sbjct: 409 SIVLVLLYLYLTPCPCKCKTKRQKNML 435
>AMGO2_HUMAN (Q86SJ2) Amphoterin-induced protein 2 precursor (AMIGO-2)| (Alivin-1) (Differentially expressed in gastric adenocarcinomas) (DEGA) Length = 522 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 159 SIYLSYLFLRICVCPCSCTNMARENML 79 SI L L+L + CPC C ++NML Sbjct: 409 SIVLVLLYLYLTPCPCKCKTKRQKNML 435
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 118 TYTYS*EQIRKINGEGKPKAMSELTKLQWHFICGPSSV 231 T+ Y I +NGEG K + L ++ +CGPS V Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGV 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,410,116 Number of Sequences: 219361 Number of extensions: 614280 Number of successful extensions: 1312 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)