| Clone Name | rbah62m22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3 | 32 | 1.1 | 2 | YBS4_YEAST (P38244) Hypothetical protein YBR074W | 32 | 1.9 | 3 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 31 | 2.5 | 4 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 31 | 2.5 | 5 | NOG2_CANGA (Q6FWS1) Nucleolar GTP-binding protein 2 | 31 | 3.3 | 6 | MATK_CHAFS (Q5YJU7) Maturase K (Intron maturase) | 30 | 4.2 | 7 | RF1_ANASP (Q8YPK9) Peptide chain release factor 1 (RF-1) | 29 | 9.5 | 8 | NOG2_YEAST (P53742) Nucleolar GTP-binding protein 2 | 29 | 9.5 |
|---|
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 608 ENDVDIPLVSVYFR 567 ENDVDIPLVSVYFR Sbjct: 1040 ENDVDIPLVSVYFR 1053
>YBS4_YEAST (P38244) Hypothetical protein YBR074W| Length = 976 Score = 31.6 bits (70), Expect = 1.9 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -3 Query: 167 FSIRIFFSVDVCSCTLRYLIQIFGLAQRSRLGRQVPDHERGLAADAGV 24 + + IFF + + LR L G+ R RLGR+ DH ++ + + Sbjct: 493 YPLSIFFLLSTIAAILRLLALALGMRTRKRLGRECRDHHSNYSSHSQI 540
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 608 ENDVDIPLVSVYFR 567 +NDVDIPLVSVYFR Sbjct: 1038 DNDVDIPLVSVYFR 1051
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 608 ENDVDIPLVSVYFR 567 +NDVDIPLVSVYFR Sbjct: 1038 DNDVDIPLVSVYFR 1051
>NOG2_CANGA (Q6FWS1) Nucleolar GTP-binding protein 2| Length = 494 Score = 30.8 bits (68), Expect = 3.3 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 8/54 (14%) Frame = +2 Query: 83 IFEPDQKSESNISRCNCKHLRR--KIS*WKNVTD----SARRLGELT--G*PEE 220 + P+Q + RC KHL R +IS WK+ TD AR+ G L G P+E Sbjct: 393 VSHPEQYIPGVLKRCQTKHLERTYEISGWKDATDFIEMLARKQGRLLKGGEPDE 446
>MATK_CHAFS (Q5YJU7) Maturase K (Intron maturase)| Length = 499 Score = 30.4 bits (67), Expect = 4.2 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = -2 Query: 213 GYPVSSPSLLAESVTFFHQDIFLRRCLQLHLEIFDSDFWSGSKIEAGQTSAGSRTRFSC 37 G+P+S P + A+S F D+FLRRC L S +++GS + R SC Sbjct: 384 GHPISKP-VWADSADFDIIDLFLRRCRNL------SHYYNGSSTKKSLYRIKHILRLSC 435
>RF1_ANASP (Q8YPK9) Peptide chain release factor 1 (RF-1)| Length = 366 Score = 29.3 bits (64), Expect = 9.5 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +1 Query: 316 NYLNATNEQIAAGPVYHKERTS*GNHDM--IDRSARERRLDYIRDSAKLVLESRPEDDDA 489 N+ A E I A V + + H+M ++ E ++DY+ K++L R +DD Sbjct: 55 NWKIAQEELIGARQVLKEANSDPDMHEMAALEVKELEEKIDYLETRLKVLLLPRDPNDDK 114 Query: 490 RFFILLVLEKSRPGDDA 540 I+L + GD+A Sbjct: 115 N--IMLEIRAGTGGDEA 129
>NOG2_YEAST (P53742) Nucleolar GTP-binding protein 2| Length = 486 Score = 29.3 bits (64), Expect = 9.5 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 8/54 (14%) Frame = +2 Query: 83 IFEPDQKSESNISRCNCKHLRR--KIS*WKNVTD----SARRLGELT--G*PEE 220 + P+Q + RC KHL R +IS WK+ T+ AR+ G L G P+E Sbjct: 393 VTHPEQYIPGVLKRCQVKHLERTYEISGWKDATEFIEILARKQGRLLKGGEPDE 446 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,011,347 Number of Sequences: 219361 Number of extensions: 1708967 Number of successful extensions: 3881 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3880 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)