| Clone Name | rbah62m21 |
|---|---|
| Clone Library Name | barley_pub |
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 90.5 bits (223), Expect = 2e-18 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 348 YKL VSHMGTS HCGHYVAHILK+GRW IFND+KV S D PKDMGY+Y Sbjct: 741 YKLFGIVSHMGTSVHCGHYVAHILKEGRWVIFNDDKVGISTDPPKDMGYVY 791
>UBP5_MOUSE (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 82.8 bits (203), Expect = 5e-16 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 348 Y+L AF+SHMGTST CGHYV HI K+GRW I+ND KV AS PKD+GY+Y Sbjct: 801 YQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIY 851
>UBP5_HUMAN (P45974) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 82.8 bits (203), Expect = 5e-16 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 348 Y+L AF+SHMGTST CGHYV HI K+GRW I+ND KV AS PKD+GY+Y Sbjct: 801 YQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIY 851
>UBP13_HUMAN (Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) Length = 863 Score = 78.6 bits (192), Expect = 9e-15 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 348 Y+L AF+SHMGTST GHY+ HI K+GRW I+ND+KV AS PKD+GY+Y Sbjct: 806 YELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDHKVCASERPPKDLGYMY 856
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 65.1 bits (157), Expect = 1e-10 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 348 Y+L F+SH+G + CGHYV HI K+ RW FND V S PK++GY+Y Sbjct: 780 YELLGFISHLGNNVTCGHYVCHIKKNNRWIKFNDRHVQLSEQPPKELGYIY 830
>UBP14_SCHPO (Q11119) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (UBA-domain-containing protein 2) Length = 775 Score = 53.9 bits (128), Expect = 2e-07 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 6/57 (10%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILK--DGR--WTIFNDNKV--AASVDLPKDMGYLY 348 Y L A +SH G+S H GHYVA I K DG+ W +FND KV AS++ K GY+Y Sbjct: 713 YNLKAIISHKGSSAHAGHYVAFIRKEIDGKQQWVLFNDEKVLQVASLEEAKTTGYVY 769
>UBP14_YEAST (P38237) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (Glucose-induced degradation protein 6) Length = 803 Score = 47.4 bits (111), Expect = 2e-05 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 6/57 (10%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILK----DGRWTIFNDNKVAA--SVDLPKDMGYLY 348 Y LTA + H G S H GHYV I K +W ++ND K+ A S++ K GY+Y Sbjct: 742 YALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIEDMKKNGYIY 798
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAAS 381 Y L A V H G+ GHY A+ + +GRW FND+ V + Sbjct: 454 YDLAAVVVHHGSGVGSGHYTAYAVHEGRWFHFNDSTVTVT 493
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 39.3 bits (90), Expect = 0.006 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y L A V H G+ GHY A+ +GRW FND+ V Sbjct: 455 YDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTV 491
>UBP37_HUMAN (Q86T82) Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.1.2.15)| (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37) (Deubiquitinating enzyme 37) Length = 979 Score = 36.6 bits (83), Expect = 0.039 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 7/58 (12%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI--LKDGRWTIFNDNKVA----ASVDLPKD-MGYLY 348 Y+L + VSH+G+++ GHY++ + +K W +ND +V+ A+V +D GY++ Sbjct: 889 YRLISVVSHIGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIF 946
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 36.6 bits (83), Expect = 0.039 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI--LKDGRWTIFNDNKV 390 Y L ++H G S+ GHYVA + +DG+W +F+D V Sbjct: 392 YDLKGIITHKGRSSQDGHYVAWMRSSEDGKWRLFDDEHV 430
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 36.2 bits (82), Expect = 0.051 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI---LKDGRWTIFNDNKVA 387 Y L ++H G ++ GHY A I L + +W FND+KV+ Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 36.2 bits (82), Expect = 0.051 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 360 Y L A ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 417 YDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKV--SIVTPEDI 462
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 36.2 bits (82), Expect = 0.051 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 360 Y L A ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 416 YDLQAVLTHQGRSSSSGHYVSWVRRKQDEWIKFDDDKV--SIVTPEDI 461
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 36.2 bits (82), Expect = 0.051 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 360 Y L A ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 417 YDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKV--SIVTPEDI 462
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 35.8 bits (81), Expect = 0.066 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 360 Y L A ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 416 YDLQAVLTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKV--SIVTPEDI 461
>UBP29_MOUSE (Q9ES63) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 869 Score = 35.4 bits (80), Expect = 0.086 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI--LKDGRWTIFNDNKVAASVD 375 Y+L + VSH G+S + GHYV+ + + W +++D +V S D Sbjct: 764 YRLVSVVSHFGSSPNSGHYVSDVYDFQKQAWLLYSDVQVFESSD 807
>UBP10_YEAST (P53874) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) Length = 792 Score = 35.0 bits (79), Expect = 0.11 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILK-DGRWTIFNDNKV 390 Y+L + V H G S GHY+AH + DG W ++D + Sbjct: 674 YQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYI 711
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 34.7 bits (78), Expect = 0.15 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVA--ASVDLPKDMGYL 351 Y+L VSH GT GHY+A + G+W FND+ V+ + ++ K+ YL Sbjct: 411 YELIGIVSHKGTVNE-GHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYL 462
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y L A V H+G+ + GHYV+ + W F+D V Sbjct: 298 YSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENV 334
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y L A V H+G+ + GHYV+ + W F+D V Sbjct: 293 YSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDESV 329
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y L A V H G+ + GHY+ + G W +F+D+ V Sbjct: 296 YDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIV 332
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y L A V H G+ + GHY+ + G W +F+D+ V Sbjct: 296 YDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIV 332
>UBP18_MOUSE (Q9WTV6) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) Length = 368 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILK--DGRWTIFNDNKV 390 Y+L A ++H+G + GHY A+I DG+W FND+ V Sbjct: 298 YELFAVIAHVGMADF-GHYCAYIRNPVDGKWFCFNDSHV 335
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 33.5 bits (75), Expect = 0.33 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAAS 381 Y L A + H G S H GHY ++ +G+W ND+ V +S Sbjct: 365 YGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSS 405
>UBP12_HUMAN (O75317) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) (Ubiquitin hydrolyzing enzyme 1) Length = 355 Score = 33.1 bits (74), Expect = 0.43 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y L A V H G+ + GHY+A + W +F+D+ V Sbjct: 285 YDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIV 321
>UBPX_CAEEL (P34547) Probable ubiquitin carboxyl-terminal hydrolase R10E11.3| (EC 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 410 Score = 32.7 bits (73), Expect = 0.56 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y L A V H G + + GHY+ + + W +F+D+ V Sbjct: 325 YDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDIV 361
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 32.7 bits (73), Expect = 0.56 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 6/86 (6%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI--LKDGRWTIFNDNK--VAASVDLPKDMGYL--YXXX 339 Y L+A V H G GHY A+ + G W ND+K V + ++ K Y+ Y Sbjct: 598 YDLSAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQR 657 Query: 338 XXXXXXXXFEVIVHAHISSGSMADGR 261 E + A + S + +GR Sbjct: 658 TVQGNARISETHLQAQVQSSNNDEGR 683
>UBP18_HUMAN (Q9UMW8) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) (hUBP43) Length = 372 Score = 32.7 bits (73), Expect = 0.56 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILK--DGRWTIFNDNKV 390 Y+L A ++H+G + GHY +I DG+W FND+ + Sbjct: 302 YELFAVIAHVGMADS-GHYCVYIRNAVDGKWFCFNDSNI 339
>UBP29_HUMAN (Q9HBJ7) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 922 Score = 32.7 bits (73), Expect = 0.56 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI--LKDGRWTIFND 399 Y+L + VSH+G+S + GHY++ + + W +ND Sbjct: 823 YRLISVVSHIGSSPNSGHYISDVYDFQKQAWFTYND 858
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 32.3 bits (72), Expect = 0.73 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVA 387 Y+L A +H G S H GHY A W ++ND++V+ Sbjct: 502 YQLYALCNHSG-SVHYGHYTALCRCQTGWHVYNDSRVS 538
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 32.3 bits (72), Expect = 0.73 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVA 387 Y+L A +H G S H GHY A W ++ND++V+ Sbjct: 503 YQLYALCNHSG-SVHYGHYTALCRCQTGWHVYNDSRVS 539
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 32.0 bits (71), Expect = 0.95 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 6/88 (6%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI--LKDGRWTIFNDNK--VAASVDLPKDMGYL--YXXX 339 Y L+A V H G GHY A+ + G W ND+K V + ++ K Y+ Y Sbjct: 595 YDLSAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLDVCSVEEVCKTQAYILFYTRR 654 Query: 338 XXXXXXXXFEVIVHAHISSGSMADGRRT 255 E + A + S S D RRT Sbjct: 655 TVQGSAKLSEPHLQAQVHSSS-KDERRT 681
>ATG1_CANGA (Q6FL58) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 942 Score = 32.0 bits (71), Expect = 0.95 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -1 Query: 165 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 16 F R+ +TS+ L L+M E L ++ YN A W + +LFE CC Sbjct: 201 FARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVLFEMCC 249
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 32.0 bits (71), Expect = 0.95 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAAS 381 Y L A + H G + H GHY +I +G W ND+ V+ S Sbjct: 354 YVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTS 394
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKV 390 Y L++ + H+G H GHYV+ + K W +F+D V Sbjct: 358 YYLSSVIVHVGGGPHRGHYVSIVRTKTYGWVLFDDENV 395
>UBP6_SCHPO (Q92353) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thiolesterase 6) (Ubiquitin-specific processing protease 6) (Deubiquitinating enzyme 6) Length = 467 Score = 31.6 bits (70), Expect = 1.2 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKD---GRWTIFNDNKVA 387 Y L +SH G S GHY A I W FND KV+ Sbjct: 397 YDLVGVLSHAGASASSGHYQAWIRNSNNRAEWFRFNDAKVS 437
>UBP11_SCHPO (Q9UUD6) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 350 Score = 30.8 bits (68), Expect = 2.1 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAAS 381 Y L + ++H G+ T+ GHY+ + L+D W ND+ + S Sbjct: 286 YILRSLITHSGSVTY-GHYLCYRLQDDIWWKANDSLITKS 324
>ATG1_YEAST (P53104) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) (Autophagy protein 3) (Cytoplasm to vacuole targeting protein 10) Length = 897 Score = 29.6 bits (65), Expect = 4.7 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -1 Query: 165 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 16 F R+ TS+ L L+M E L ++ YN A W + ++FE CC Sbjct: 214 FARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVVFEMCC 262
>ATG1_ASHGO (Q75CH3) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 972 Score = 29.6 bits (65), Expect = 4.7 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -1 Query: 165 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 16 F R+ TS+ L L+M E L ++ YN A W + +L+E CC Sbjct: 208 FARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVLYEMCC 256
>ATG1_KLULA (Q6CSX2) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 831 Score = 29.6 bits (65), Expect = 4.7 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -1 Query: 165 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 16 F R+ TS+ L L+M E L ++ YN A W + +L+E CC Sbjct: 210 FARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVLYEMCC 258
>UBP13_YEAST (P38187) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) Length = 688 Score = 29.3 bits (64), Expect = 6.2 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGR--WTIFNDNKVAA 384 Y+L V HMG GHYV+ + K + W +F+D V A Sbjct: 602 YELAGIVVHMGGGPQHGHYVS-LCKHEKFGWLLFDDETVEA 641
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHIL--KDGRWTIFNDNKVA 387 Y L+A V H G GHY A+ + G W ND+K++ Sbjct: 619 YDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLS 658
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 29.3 bits (64), Expect = 6.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKV 390 Y L A + H G ++H GHY + G+W +D KV Sbjct: 290 YALYAVLVHDGATSHSGHYFCCVKAGHGKWYKMDDTKV 327
>PITM2_MOUSE (Q6ZPQ6) Membrane-associated phosphatidylinositol transfer protein| 2 (Phosphatidylinositol transfer protein, membrane-associated 2) (Pyk2 N-terminal domain-interacting receptor 3) (NIR-3) (Drosophila retinal degeneration B homolog 2) (RdgB2) Length = 1335 Score = 29.3 bits (64), Expect = 6.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 189 ISLETSTSGCGEMVASSQICTKSPSTIRHAP 281 IS+ + SG E +S I K PS++ H P Sbjct: 822 ISIASQVSGMAESYTASSIAQKGPSSLNHTP 852
>UBP26_HUMAN (Q9BXU7) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 913 Score = 29.3 bits (64), Expect = 6.2 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYV--AHILKDGRWTIFNDNKV 390 Y+L + VSH+G + GHY+ A+ + W ++D +V Sbjct: 824 YRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRV 862
>RIR1_SYNY3 (P74240) Ribonucleoside-diphosphate reductase alpha subunit (EC| 1.17.4.1) (Ribonucleotide reductase) Length = 767 Score = 28.9 bits (63), Expect = 8.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 479 SHMGTS--THCGHYVAHILKDGRWTIFNDNKVAASVD 375 +H GTS +H GH + I +DG T N K+ A VD Sbjct: 17 AHAGTSQGSHQGHRIQVIRRDGSSTPLNIGKIRAVVD 53
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 28.9 bits (63), Expect = 8.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 390 Y+L + V H GT GHY+A+ +W + +D + Sbjct: 379 YQLYSVVCHKGT-LDTGHYIAYTYYQNQWFLLDDTTI 414
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 28.9 bits (63), Expect = 8.1 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 500 YKLTAFVSHMGTSTHCGHYVAHIL--KDGRWTIFNDNKVAASVD 375 YKLT + H G S+ GHY A + + +W +D + D Sbjct: 844 YKLTGVIYHHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELED 887 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,044,298 Number of Sequences: 219361 Number of extensions: 1657731 Number of successful extensions: 3839 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 3749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3834 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)