Clone Name | rbah62m19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATC1_DROPS (Q292Q0) Calcium-transporting ATPase sarcoplasmic/end... | 29 | 4.1 | 2 | SAG1_YEAST (P20840) Alpha-agglutinin precursor (AG-alpha-1) | 29 | 5.4 | 3 | L_SYNV (P31332) Large structural protein (L protein) (Transcript... | 28 | 9.2 |
---|
>ATC1_DROPS (Q292Q0) Calcium-transporting ATPase sarcoplasmic/endoplasmic| reticulum type (EC 3.6.3.8) (Calcium pump) Length = 1020 Score = 29.3 bits (64), Expect = 4.1 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -3 Query: 224 CAKFQEPKSMVSSLSVLTALGNLHAL--FEETTSTSXMPVRC 105 C F +PK+M +LSVL + L+A+ E S MP C Sbjct: 888 CKIFSDPKAMTMALSVLVTIEMLNAMNSLSENQSLISMPPWC 929
>SAG1_YEAST (P20840) Alpha-agglutinin precursor (AG-alpha-1)| Length = 650 Score = 28.9 bits (63), Expect = 5.4 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 127 VEVVSSN--NAWRFPRAVNTLNEDTIDFGS 210 V+V SSN N W FP++ N N D FGS Sbjct: 230 VQVYSSNDFNDWWFPQSYNDTNADVTCFGS 259
>L_SYNV (P31332) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2116 Score = 28.1 bits (61), Expect = 9.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 130 EVVSSNNAWRFPRAVNTLNEDTIDFGSWNL 219 EV+SS W + LN+DTI +W L Sbjct: 1427 EVISSRMTWVVTLCSHLLNQDTIKHSTWKL 1456 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,329,159 Number of Sequences: 219361 Number of extensions: 1132885 Number of successful extensions: 2605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2605 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)