ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbah62m18 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 50.8 bits (120), Expect = 9e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESGKA 215 MRQVQCVSF AFKPPGCEESGKA Sbjct: 91 MRQVQCVSFIAFKPPGCEESGKA 113
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESGKA 215 MRQVQCVSF AF+PPGCEESGKA Sbjct: 153 MRQVQCVSFIAFRPPGCEESGKA 175
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESGKA 215 MRQVQCVSF AFKPPGC+ESGKA Sbjct: 152 MRQVQCVSFIAFKPPGCQESGKA 174
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESGKA 215 +RQVQCVSF AF+PPGCEESGKA Sbjct: 152 LRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESGKA 215 MRQVQ VSF A KPPGCEESGKA Sbjct: 153 MRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESG 221 +RQVQ +SF A+KPPGCEESG Sbjct: 153 VRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESG 221 +RQVQ +SF A+KPPGCEESG Sbjct: 153 VRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 34.3 bits (77), Expect = 0.084 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 280 RQVQCVSFFAFKPPG 236 RQVQCVSF AFKPPG Sbjct: 165 RQVQCVSFIAFKPPG 179
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KPPG Sbjct: 164 VRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KPPG Sbjct: 164 VRQVQCISFIAYKPPG 179
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KPPG Sbjct: 162 VRQVQCISFIAYKPPG 177
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KPPG Sbjct: 166 VRQVQCISFLAYKPPG 181
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCE 230 +RQVQC+SF A+KP G E Sbjct: 166 VRQVQCISFLAYKPKGAE 183
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 31.6 bits (70), Expect = 0.54 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 280 RQVQCVSFFAFKPPGCEES 224 RQVQC+SF A+KPP E+ Sbjct: 163 RQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 31.6 bits (70), Expect = 0.54 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 280 RQVQCVSFFAFKPPGCEES 224 RQVQC+SF A+KPP E+ Sbjct: 163 RQVQCISFIAYKPPSFTEA 181
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCE 230 ++Q QCVSF A+KPPG + Sbjct: 153 IKQTQCVSFIAYKPPGSD 170
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 31.2 bits (69), Expect = 0.71 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPGCEESG 221 +RQVQ +SF A+ PGCEESG Sbjct: 151 VRQVQLISFIAYN-PGCEESG 170
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 30.8 bits (68), Expect = 0.93 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 283 MRQVQCVSFFAFKPP 239 +RQVQC+SF A+KPP Sbjct: 162 VRQVQCISFIAYKPP 176
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 30.8 bits (68), Expect = 0.93 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 283 MRQVQCVSFFAFKPP 239 +RQVQC+SF A+KPP Sbjct: 162 VRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 30.8 bits (68), Expect = 0.93 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 283 MRQVQCVSFFAFKPP 239 +RQVQC+SF A+KPP Sbjct: 162 VRQVQCISFIAYKPP 176
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKPP 239 RQVQC+SF A+KPP Sbjct: 163 RQVQCISFIAYKPP 176
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKPP 239 RQVQC+SF A+KPP Sbjct: 167 RQVQCISFIAYKPP 180
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKPP 239 RQVQC+SF A+KPP Sbjct: 163 RQVQCISFIAYKPP 176
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKPP 239 RQVQC+SF A+KPP Sbjct: 163 RQVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKPP 239 RQVQC+SF A+KPP Sbjct: 163 RQVQCISFIAYKPP 176
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKPP 239 RQVQC+SF A+KPP Sbjct: 163 RQVQCISFIAYKPP 176
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKPP 239 RQVQC+SF A+KPP Sbjct: 64 RQVQCISFIAYKPP 77
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 280 RQVQCVSFFAFKPPG 236 RQVQCVSF A+KP G Sbjct: 165 RQVQCVSFIAYKPAG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 164 VRQVQCISFIAYKPEG 179
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 167 VRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 167 VRQVQCISFIAYKPAG 182
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 280 RQVQCVSFFAFKPPG 236 RQVQCVSF A+KP G Sbjct: 167 RQVQCVSFIAYKPAG 181
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 166 VRQVQCISFIAYKPKG 181
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 165 VRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 165 VRQVQCISFIAYKPEG 180
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 165 VRQVQCISFIAYKPEG 180
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 165 VRQVQCISFIAYKPEG 180
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A+KP G Sbjct: 165 VRQVQCISFIAYKPEG 180
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 280 RQVQCVSFFAFKPPG 236 RQVQC+SF A+KP G Sbjct: 165 RQVQCISFIAYKPTG 179
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF KPPG Sbjct: 164 IRQVQCISFIVAKPPG 179
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 280 RQVQCVSFFAFKPPG 236 RQVQ +SF A+KPPG Sbjct: 167 RQVQIISFIAYKPPG 181
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQCVSF A KP G Sbjct: 157 VRQVQCVSFIASKPTG 172
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQCVSF A+KP Sbjct: 165 VRQVQCVSFIAYKP 178
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQCVSF A+KP Sbjct: 164 VRQVQCVSFIAYKP 177
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 280 RQVQCVSFFAFKPPG 236 R+VQC+SF A+KP G Sbjct: 108 REVQCISFIAYKPAG 122
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQCVSF A+KP Sbjct: 168 VRQVQCVSFIAYKP 181
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQC+SF A+KP Sbjct: 164 VRQVQCISFIAYKP 177
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQC+SF A+KP Sbjct: 162 VRQVQCISFIAYKP 175
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A KP G Sbjct: 157 VRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A KP G Sbjct: 157 VRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A KP G Sbjct: 157 VRQVQCISFIASKPDG 172
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 280 RQVQCVSFFAFKPPG 236 RQVQC+SF +KP G Sbjct: 163 RQVQCISFLTYKPEG 177
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQC+SF A+KP Sbjct: 164 VRQVQCISFIAYKP 177
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A KP G Sbjct: 162 VRQVQCISFIASKPDG 177
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQC+SF A+KP Sbjct: 165 VRQVQCISFIAYKP 178
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A KP G Sbjct: 162 VRQVQCISFIASKPEG 177
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQC+SF A+KP Sbjct: 164 VRQVQCISFIAYKP 177
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQCVSF A+KP Sbjct: 168 RQVQCVSFIAYKP 180
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 283 MRQVQCVSFFAFKP 242 +RQVQC+SF A+KP Sbjct: 166 VRQVQCISFIAYKP 179
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQC+SF A+KP Sbjct: 160 RQVQCISFIAYKP 172
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 283 MRQVQCVSFFAFKPPG 236 +RQVQC+SF A KP G Sbjct: 157 VRQVQCISFIASKPGG 172
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 92 TYTYX*EQIRXINGEGKPKAMSELTKLQWHFICGPS 199 T+ Y I +NGEG K + L ++ +CGPS Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPS 191
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQC+SF A+KP Sbjct: 164 RQVQCISFIAYKP 176
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQC+SF A+KP Sbjct: 164 RQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQC+SF A+KP Sbjct: 164 RQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQC+SF A+KP Sbjct: 164 RQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQC+SF A+KP Sbjct: 164 RQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 280 RQVQCVSFFAFKP 242 RQVQC+SF A+KP Sbjct: 164 RQVQCISFIAYKP 176 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,344,367 Number of Sequences: 219361 Number of extensions: 522850 Number of successful extensions: 1058 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
