Clone Name | rbah62m10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATPG_PROMM (Q7V5S8) ATP synthase gamma chain (EC 3.6.3.14) (ATP ... | 32 | 1.2 |
---|
>ATPG_PROMM (Q7V5S8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 316 Score = 32.3 bits (72), Expect = 1.2 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 472 DDIARLNSRDPRADFGKGLPPGNHKSPLPGSI 567 D+I RL ++D R KG+ P N + PLP I Sbjct: 205 DEIFRLTTKDSRLTVEKGVGPANEQPPLPSDI 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,059,228 Number of Sequences: 219361 Number of extensions: 1924004 Number of successful extensions: 4418 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4414 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)