Clone Name | rbah63b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
---|---|---|---|
1 | AAPQ_RHILV (Q52813) General L-amino acid transport system permea... | 30 | 4.6 |
>AAPQ_RHILV (Q52813) General L-amino acid transport system permease protein| aapQ Length = 400 Score = 30.4 bits (67), Expect = 4.6 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -2 Query: 462 ILASIVIRYTTSKKVRAVLLYNMTIHQLIAPSRRILFLISSFHMYKFIASIKAGGI 295 +L +V + + V +N+T ++ P LFL SF+ FIA I GGI Sbjct: 237 LLVFVVSGFPLTFDVPVAGKFNLTGGSVVGPEFMSLFLALSFYTASFIAEIVRGGI 292 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,602,684 Number of Sequences: 219361 Number of extensions: 1916504 Number of successful extensions: 3584 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3584 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)