Clone Name | rbah63a12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DNLI_BPT3 (P07717) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleot... | 30 | 1.2 | 2 | KAB7_YEAST (P31374) Probable serine/threonine-protein kinase YAL... | 27 | 9.9 |
---|
>DNLI_BPT3 (P07717) DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide synthase| [ATP]) Length = 346 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +2 Query: 131 GKFNFTVLLQLTSLNVYACLPLLISRS--KFNTMSLFQPLHTPSRSCILLIHFFP 289 GKF F + + S+ +YA +P+ I+ S ++ +L P H + LL+ +FP Sbjct: 139 GKFEFHLDPKRLSVRLYAVMPIHIAESGEDYDVQNLLMPYHVEAMRS-LLVEYFP 192
>KAB7_YEAST (P31374) Probable serine/threonine-protein kinase YAL017W (EC| 2.7.11.1) Length = 1356 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 158 QLTSLNVYACLPLLISRSKFNTMSLFQPLHTPSRSCIL 271 Q + N ACL IS++ ++L +HT SR+ +L Sbjct: 473 QFRAANDLACLVFGISQNAIRALTLMDLIHTDSRNFVL 510 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,400,526 Number of Sequences: 219361 Number of extensions: 702689 Number of successful extensions: 1344 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1344 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)