| Clone Name | rbah63a08 |
|---|---|
| Clone Library Name | barley_pub |
>SCS7_YEAST (Q03529) Inositolphosphorylceramide-B C-26 hydroxylase (EC 1.-.-.-)| (IPC-B hydroxylase) Length = 384 Score = 117 bits (294), Expect = 2e-26 Identities = 61/127 (48%), Positives = 76/127 (59%), Gaps = 4/127 (3%) Frame = -1 Query: 615 FLFHIETKSYWSNTA---HYLIHGCHHKHPMDSLRLVFPPAGAAILCVPFWNVVAFFASP 445 FLFH + SN A H+L+HGCHH PMD RLV PP ILC PF+ +V Sbjct: 246 FLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPL 305 Query: 444 STTPALFAGGLLGYVMYDCTYYYLHHGQPSIDP-AKHLKRYHLSHHFRIQDKGFGITSSL 268 A FAGGL GYV YD +++LHH + + P + LK+YHL HH++ GFG+TS Sbjct: 306 YWAYAGFAGGLFGYVCYDECHFFLHHSK--LPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363 Query: 267 WDAVFGT 247 WD VFGT Sbjct: 364 WDEVFGT 370
>AEGP_RAT (Q63191) Apical endosomal glycoprotein precursor| Length = 1216 Score = 30.0 bits (66), Expect = 5.6 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -1 Query: 453 ASPSTTPALFAGGLLGYVMYDCT---YYYLH 370 A P TT L++ G V Y+C+ YYYLH Sbjct: 321 AKPGTTAVLYSPEFQGSVSYNCSFTFYYYLH 351
>MEGL_PSEPU (P13254) Methionine gamma-lyase (EC 4.4.1.11) (L-methioninase)| Length = 398 Score = 29.3 bits (64), Expect = 9.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 414 LLGYVMYDCTYYYLHHG 364 LLG +Y CT+ +LHHG Sbjct: 108 LLGNTLYGCTFAFLHHG 124
>EDDF1_HUMAN (O60584) Erythroid differentiation and denucleation factor 1| Length = 74 Score = 29.3 bits (64), Expect = 9.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 497 APAGGNTSLSESIGCLWWHPWI 562 A AGG SL S+ C W PWI Sbjct: 34 AQAGGPASLLASLTCWGWRPWI 55
>ANAG_HUMAN (P54802) Alpha-N-acetylglucosaminidase precursor (EC 3.2.1.50)| (N-acetyl-alpha-glucosaminidase) (NAG) [Contains: Alpha-N-acetylglucosaminidase 82 kDa form; Alpha-N-acetylglucosaminidase 77 kDa form] Length = 743 Score = 29.3 bits (64), Expect = 9.6 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = -1 Query: 441 TTPALFAGGLLGYVMYDCTYYYLHHGQPSIDPAKHLKRYHLSHHFRIQDKGFGITSSLWD 262 T PA A G +G LH + P+ H+K+ +L H Q + FG+T L Sbjct: 194 TGPAFLAWGRMGN---------LHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVL-P 243 Query: 261 AVFGTLPSS 235 A G +P + Sbjct: 244 AFAGHVPEA 252
>TRPE_SCHPO (O94582) Probable anthranilate synthase component 1 (EC 4.1.3.27)| (Anthranilate synthase component I) Length = 489 Score = 29.3 bits (64), Expect = 9.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 426 FAGGLLGYVMYDCTYYY 376 F+GG +GYV YDC Y+ Sbjct: 104 FSGGAVGYVSYDCIKYF 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,976,121 Number of Sequences: 219361 Number of extensions: 1992413 Number of successful extensions: 5252 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5246 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)