Clone Name | rbah63a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HISZ_RALSO (Q8Y020) ATP phosphoribosyltransferase regulatory sub... | 31 | 2.3 | 2 | FLO9_YEAST (P39712) Flocculation protein FLO9 precursor | 29 | 8.9 | 3 | FLO1_YEAST (P32768) Flocculation protein FLO1 precursor (Floccul... | 29 | 8.9 |
---|
>HISZ_RALSO (Q8Y020) ATP phosphoribosyltransferase regulatory subunit| Length = 386 Score = 30.8 bits (68), Expect = 2.3 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 517 LDKLESVEFH-GGAAPKIELLQFRGWRYKANTVLFAGLPSLPSLKQVLLKGRYE 359 LD L ++ H GGAA I+L RG+ Y + + A + +P+ V GRY+ Sbjct: 240 LDDLATLAAHAGGAAVNIDLADLRGYHYHSGVMFAAYVAGVPN--AVARGGRYD 291
>FLO9_YEAST (P39712) Flocculation protein FLO9 precursor| Length = 1322 Score = 28.9 bits (63), Expect = 8.9 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 396 GRDGSPANKTVLAL*RQPRNCSSSIFGAAPPWNSTDSSLS 515 G +G P ++TV+ + R P +S+I PWNST +S S Sbjct: 299 GTNGVPTDETVIVI-RTPTT-ASTIITTTEPWNSTFTSTS 336
>FLO1_YEAST (P32768) Flocculation protein FLO1 precursor (Flocculin-1)| Length = 1537 Score = 28.9 bits (63), Expect = 8.9 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 396 GRDGSPANKTVLAL*RQPRNCSSSIFGAAPPWNSTDSSLS 515 G +G P ++TV+ + R P +S+I PWNST +S S Sbjct: 299 GTNGVPTDETVIVI-RTPTT-ASTIITTTEPWNSTFTSTS 336 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,763,498 Number of Sequences: 219361 Number of extensions: 1672128 Number of successful extensions: 4161 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4158 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)