| Clone Name | rbah62k10 |
|---|---|
| Clone Library Name | barley_pub |
>FTSH2_ARATH (Q9FH02) Cell division protein ftsH homolog 2, chloroplast| precursor (EC 3.4.24.-) Length = 704 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 152 GEEFMSLFIDGQAXLFVA 99 GEEFMSLFIDGQA L+V+ Sbjct: 687 GEEFMSLFIDGQAELYVS 704
>FTSH1_ARATH (Q39102) Cell division protein ftsH homolog 1, chloroplast| precursor (EC 3.4.24.-) Length = 716 Score = 33.9 bits (76), Expect = 0.13 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 152 GEEFMSLFIDGQAXLFVA 99 GEEFMSLFIDGQA L+++ Sbjct: 699 GEEFMSLFIDGQAELYIS 716
>FTSH_MEDSA (Q9BAE0) Cell division protein ftsH homolog, chloroplast precursor| (EC 3.4.24.-) Length = 706 Score = 32.7 bits (73), Expect = 0.28 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -2 Query: 152 GEEFMSLFIDGQAXLFVA 99 GEEFMSLFIDG+A L+V+ Sbjct: 689 GEEFMSLFIDGKAELYVS 706
>FTSH_TOBAC (O82150) Cell division protein ftsH homolog, chloroplast precursor| (EC 3.4.24.-) (DS9) Length = 714 Score = 32.7 bits (73), Expect = 0.28 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = -2 Query: 152 GEEFMSLFIDGQAXLFVA*VA 90 GEEFMSLFIDG+A L+++ V+ Sbjct: 690 GEEFMSLFIDGKAELYISWVS 710
>TSG6_RABIT (P98065) Tumor necrosis factor-inducible protein TSG-6 precursor| (TNF-stimulated gene 6 protein) (Hyaluronate-binding protein PS4) Length = 276 Score = 29.3 bits (64), Expect = 3.1 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 7 KNNIXTRSMWFLQAGPSYNRRKHTGHDGATYATNSXAC 120 KN I S+W QA Y+R +G TYA C Sbjct: 21 KNGIFHNSIWLEQAAGVYHREARSGKYKLTYAEAKAVC 58
>TSG6_MOUSE (O08859) Tumor necrosis factor-inducible protein TSG-6 precursor| (TNF-stimulated gene 6 protein) Length = 275 Score = 29.3 bits (64), Expect = 3.1 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 7 KNNIXTRSMWFLQAGPSYNRRKHTGHDGATYATNSXAC 120 KN I S+W QA Y+R G TYA C Sbjct: 21 KNGIFHNSIWLEQAAGVYHREARAGRYKLTYAEAKAVC 58
>DDC_HUMAN (P20711) Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28) (AADC)| (DOPA decarboxylase) (DDC) Length = 480 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 40 LQAGPSYNRRKHTGHDGATYATNSXACPSMKRLMN 144 L+ GP N+ H A YA ++ CP + L+N Sbjct: 255 LEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLN 289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.126 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,980,043 Number of Sequences: 219361 Number of extensions: 264670 Number of successful extensions: 722 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)