Clone Name | rbah62i21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MLTE_BUCAI (P57352) Membrane-bound lytic murein transglycosylase... | 28 | 6.5 | 2 | ECR_CHITE (P49882) Ecdysone receptor (Ecdysteroid receptor) (20-... | 28 | 6.5 | 3 | Y316_MYCGE (P47558) Hypothetical protein MG316 | 28 | 8.4 |
---|
>MLTE_BUCAI (P57352) Membrane-bound lytic murein transglycosylase E (EC| 3.2.1.-) (Murein hydrolase E) Length = 221 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 120 LGTISFVFFLCCKSISLKGAVIFEYFFAS*YLNGTNILL 4 +GT S++ FL K IS+K + Y Y+NGT+ LL Sbjct: 146 IGT-SYISFLQKKFISIKNKDVMRYAIIVAYVNGTSALL 183
>ECR_CHITE (P49882) Ecdysone receptor (Ecdysteroid receptor)| (20-hydroxy-ecdysone receptor) (20E receptor) (EcRH) Length = 536 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 52 ENNCSLKRNAFAAEEENKRDCTQGMMGDNQSSKIYNGKSL 171 EN C++KR A++E +D G++G N SS +SL Sbjct: 188 ENQCAIKRKEKKAQKE--KDKVPGIVGSNTSSSSLLNQSL 225
>Y316_MYCGE (P47558) Hypothetical protein MG316| Length = 369 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -2 Query: 219 FFFLLQHRVFKQKRSK*GLSVVYFATLVVSHHTLGTISFVF-FLCC 85 F L +VFK++ + LS+ +++S+H L F F FL C Sbjct: 175 FISTLLKQVFKKQLPEDNLSLTALLIILISNHALNNFGFNFSFLAC 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,835,984 Number of Sequences: 219361 Number of extensions: 458894 Number of successful extensions: 1290 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1290 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)