| Clone Name | rbah62i12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DPOE_ASPFU (Q4WXH8) DNA polymerase epsilon, catalytic subunit A ... | 33 | 0.91 |
|---|
>DPOE_ASPFU (Q4WXH8) DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7)| (DNA polymerase II subunit A) Length = 2230 Score = 33.1 bits (74), Expect = 0.91 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 10/119 (8%) Frame = -2 Query: 668 YAYDEYIME-LKMNASLKDIDLLYFEIWRLV--YKGYRTYKDAVREVYESDNFHVHKPKL 498 YAY +Y+++ ++ NAS IDL E W + Y Y R+V S++ +L Sbjct: 1872 YAYSQYVLKSIRANASFHFIDLEIKEYWDYLVWYDEYNYGGKGCRKVTGSED-----QEL 1926 Query: 497 RAELNGGACLFVTM-QQTIYS------IALEGGIKRTDEEEKARAVFNELSFTRHKSMN 342 ++ F+ QTI+ I L G+KRTD ++ + +L H N Sbjct: 1927 ETVMHWQLSRFLPAPMQTIFHDWVVEYIELMHGLKRTDSDDSSTPRLTQLPVGNHNEDN 1985 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,503,673 Number of Sequences: 219361 Number of extensions: 2053849 Number of successful extensions: 4271 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4271 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7649585595 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)