Clone Name | rbah62i07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SLC2B_HUMAN (Q8NEV8) Slp homolog lacking C2 domains b (Exophilin-5) | 30 | 2.1 | 2 | MAML2_HUMAN (Q8IZL2) Mastermind-like protein 2 (Mam-2) | 29 | 2.7 | 3 | Y519_HAEIN (P44742) Hypothetical protein HI0519 | 28 | 6.1 |
---|
>SLC2B_HUMAN (Q8NEV8) Slp homolog lacking C2 domains b (Exophilin-5)| Length = 1989 Score = 29.6 bits (65), Expect = 2.1 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +1 Query: 25 TPMNSQDERTSLLPSASPLKNHTRCKPVVPTNIYIHGRSTNTSIVDRXPLFG 180 T +S D ++ LP +SP KN + PVVP+ RS + D+ P G Sbjct: 872 TSCDSLDLSSAALPDSSPSKNSSLDAPVVPSTTVFSRRSPS----DKDPSLG 919
>MAML2_HUMAN (Q8IZL2) Mastermind-like protein 2 (Mam-2)| Length = 1153 Score = 29.3 bits (64), Expect = 2.7 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +1 Query: 70 ASPLKNHTRCKPVVPTNIYIHGRS--TNTSIVDRXPLFGTVPCXTPTNWT*GAGPLQILR 243 A+P+ HT P HG + ++ V ++G +PC P ++ +G Q+ + Sbjct: 830 ANPVSTHTILTPNSSLLSTSHGTRMPSLSTAVQNMGMYGNLPCNQPNTYSVTSGMNQLTQ 889 Query: 244 RRN--QSIAXKN 273 +RN Q +A +N Sbjct: 890 QRNPKQLLANQN 901
>Y519_HAEIN (P44742) Hypothetical protein HI0519| Length = 417 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -3 Query: 187 EQFRIRVXGRQCLCSSIDRGYIYLLVPLAYILCDS*EAKP 68 E F I V G + S+ GY + VPL Y++ S A P Sbjct: 167 ELFAIMVGGTASIAGSVMAGYAGMGVPLTYLIAASFMAAP 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,288,470 Number of Sequences: 219361 Number of extensions: 700958 Number of successful extensions: 1719 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1718 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)