| Clone Name | rbah62h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAPS_DROME (Q9NHE5) Calcium-dependent secretion activator (dCAPS) | 31 | 1.1 | 2 | RECR_ACIAD (Q6FA18) Recombination protein recR | 28 | 7.4 | 3 | XYNA_RUMFL (P29126) Bifunctional endo-1,4-beta-xylanase xylA pre... | 28 | 7.4 | 4 | RNF17_MOUSE (Q99MV7) RING finger protein 17 | 28 | 9.7 |
|---|
>CAPS_DROME (Q9NHE5) Calcium-dependent secretion activator (dCAPS)| Length = 1436 Score = 31.2 bits (69), Expect = 1.1 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = +1 Query: 82 TIGDTTTLSLKRDVEQSPNRV*KRLDTTKPVEHTTNQRIDQHGTPKTQLLLMFIRCAQYS 261 ++G + SL R + SP+ ++ +T +P H ++R ++ + QL + RC Y Sbjct: 124 SVGSSRANSLPRPLSPSPSLTSEKHETAEP--HGKHEREEEERKRRIQLYVFISRCISYP 181 Query: 262 FD 267 F+ Sbjct: 182 FN 183
>RECR_ACIAD (Q6FA18) Recombination protein recR| Length = 198 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 326 IHGCRLCRFLSEAFVCCINLSKEY*AHLI 240 IH C++C L+E +C I LS + HL+ Sbjct: 53 IHECKICHSLTENEICDICLSNDRDQHLL 81
>XYNA_RUMFL (P29126) Bifunctional endo-1,4-beta-xylanase xylA precursor (EC| 3.2.1.8) Length = 954 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 122 WNNLQTECRNDLTRQNLWNIQQTNE*TSMG 211 WNN + ND QN WN Q N S G Sbjct: 596 WNNQGQQQNNDWNNQNNWNQGQQNNNNSAG 625
>RNF17_MOUSE (Q99MV7) RING finger protein 17| Length = 626 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 8 TKPVPSTSRNQLKPCSPTIYS 70 T+ +PS ++N KPCSPT +S Sbjct: 511 TEIIPSKTKNIRKPCSPTKFS 531 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,040,957 Number of Sequences: 219361 Number of extensions: 1328904 Number of successful extensions: 2876 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2875 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)