Clone Name | rbah62g22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RNHL_NEUCR (Q9P5X8) Probable ribonuclease HI large subunit (EC 3... | 28 | 5.1 |
---|
>RNHL_NEUCR (Q9P5X8) Probable ribonuclease HI large subunit (EC 3.1.26.4)| (RNase HI large subunit) (RNase H(35)) Length = 317 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = -1 Query: 109 LWTEFPMKRWIIGLPCDSAVLFWFNRLFHPLF---PKC 5 LW + M W G P DS + W + HP+F P+C Sbjct: 218 LWADRTMA-WGSGYPSDSKCVSWLKQNMHPVFGWGPEC 254 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,538,563 Number of Sequences: 219361 Number of extensions: 534412 Number of successful extensions: 1318 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1318 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)